14-3-3 sigma


Background

Catalog Number:

CPTC-SFN-1

Target Antigen:

14-3-3 sigma

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-SFN-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-SFN-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SFN-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-SFN-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SFN-1 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SFN-1 Western Blot

Result: Positive

Western Blot using CPTC-SFN-1 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-SFN-2

Target Antigen:

14-3-3 sigma

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-SFN-2 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-SFN-2 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-SFN-2 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-SFN-2 . Titer: 1:100 Click image to enlarge

CPTC-SFN-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-SFN-2 . Titer: 1:100


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SFN-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-SFN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-SFN-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-SFN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SFN-2 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SFN-2 Western Blot

Result: Positive

Western Blot using CPTC-SFN-2 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-SFN-3

Target Antigen:

14-3-3 sigma

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-SFN-3 for NCI60  Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click image to enlarge

CPTC-SFN-3 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-SFN-3 for NCI60 Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SFN-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-SFN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-SFN-3 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-SFN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SFN-3 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SFN-3 Western Blot

Result: Positive

Western Blot using CPTC-SFN-3 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10467

Antigen Name:

14-3-3 sigma

CPTC Name:

CPTC-SFN

Keywords:

SFN; HME1; Stratifin; OTTHUMP00000004242; YWHAS

Function:

p53-regulated inhibitor of G2/M progression

Chromosomal Localization:

1p36.11

Expression System:

E. Coli

NCBI Accession Number:

BC000995

Swiss Prot Accession Number:

P31947

DNA Source:

HIP:HsCD00005964

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

25963

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVA
YKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCD
TVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSA
RSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTT
FDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQ
S

Native Sequence:

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKN
VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
GLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSA
YQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDE
AMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Calculated Isoelectric Point:

4.68

Molecular Weight:

28046

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10467 (CPTC-SFN) (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-SFN PAGE

PAGE of Ag 10467 (CPTC-SFN) (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com