14-3-3 sigma


Background

Catalog Number:

CPTC-SFN-1

Target Antigen:

14-3-3 sigma

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-SFN-1 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SFN-1 Western Blot

Western Blot using CPTC-SFN-1 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SFN-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-SFN-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-SFN-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-SFN-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-SFN-2

Target Antigen:

14-3-3 sigma

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/24/2012

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-SFN-2 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SFN-2 Western Blot

Western Blot using CPTC-SFN-2 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SFN-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-SFN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-SFN-2 NCI 60 Protein Array

Protein Array in which CPTC-SFN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-SFN-2 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-SFN-2 IHC NCI60

Immuno-histochemistry of CPTC-SFN-2 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-SFN-2 . Titer: 1:100 Click image to enlarge

CPTC-SFN-2 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-SFN-2 . Titer: 1:100

Background

Catalog Number:

CPTC-SFN-3

Target Antigen:

14-3-3 sigma

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-SFN-3 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SFN-3 Western Blot

Western Blot using CPTC-SFN-3 as primary Ab against Ag 10467 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SFN-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-SFN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-SFN-3 NCI60 Protein Array

Protein Array in which CPTC-SFN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-SFN-3 for NCI60  Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click image to enlarge

CPTC-SFN-3 IHC NCI60

Immuno-histochemistry of CPTC-SFN-3 for NCI60 Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
Background

NCI Identification Number:

10467

Antigen Name:

14-3-3 sigma

CPTC Name:

CPTC-SFN

Keywords:

SFN; HME1; Stratifin; OTTHUMP00000004242; YWHAS;

Function:

p53-regulated inhibitor of G2/M progression

Chromosomal Localization:

1p36.11

Expression System:

E. Coli

NCBI Accession Number:

BC000995

Swiss Prot Accession Number:

P31947

DNA Source:

HIP:HsCD00005964

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

25963

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVA
YKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCD
TVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSA
RSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTT
FDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQ
S

Native Sequence:

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKN
VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
GLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSA
YQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDE
AMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Calculated Isoelectric Point:

4.68

Molecular Weight:

28046

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Immuno-histochemistry of CPTC-SFN-3 for NCI60  Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG
Click image to enlarge

CPTC-SFN PAGE

PAGE of Ag 10467 (CPTC-SFN) (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com