Serpin Peptidase Inhibitor, Clade A, Member 1


Background

Catalog Number:

CPTC-SERPINA1-1

RRID:

AB_2617341

Target Antigen:

Serpin Peptidase Inhibitor, Clade A, Member 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (149.6 KB)

CPTC-SERPINA1-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-SERPINA1-1. Titer: 1:4000 Click image to enlarge

CPTC-SERPINA1-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-SERPINA1-1. Titer: 1:4000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-SERPINA1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-SERPINA1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-SERPINA1-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-SERPINA1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500. Click image to enlarge

CPTC-SERPINA1-1 Evaluation by the Human Protein Atlas

Result: Presumed Positive (with additional bands)

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SERPINA1-1 as primary Ab against SERPINA1 (rAg 11019) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SERPINA1-1 Western blot

Result: Positive

Western Blot using CPTC-SERPINA1-1 as primary Ab against SERPINA1 (rAg 11019) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

11019

Antigen Name:

Serpin Peptidase Inhibitor, Clade A, Member 1

CPTC Name:

CPTC-SERPINA1

Keywords:

AAT; PI; PI1; alpha1AT1; alpha-1-antitrypsin1; A1AT; A1A; Serpin A1; Alpha-1 protease inhibitor; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase,
antitrypsin), member 1; OTTHUMP00000197154; MGC23330; OTTHUMP00000197150; PRO2275; MGC9222; protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin; alpha-1-antiproteinase

Function:

The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver
disease. Several transcript variants encoding the same protein have been found for this gene.

Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for
plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form
inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.

Short peptide from AAT (SPAAT) is a reversible chymotrypsin inhibitor. It also inhibits elastase, but not
trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic
destruction by human leukocyte elastase (HLE).

Chromosomal Localization:

14q32.1

Expression System:

E. Coli

NCBI Accession Number:

BC015642.2

UniProt Accession Number:

P01009

DNA Source:

OpenBiosystems - MHS1011-76439

Immunogen:

Recombinant Full Length Protein

Vector Name:

xx

Extinction Coefficient:

19940

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNS
TNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQ
ELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNF
GDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERP
FEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGN
ATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTY
DLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEA
AGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Native Sequence:

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKI
TPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEI
LEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKL
VDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKEL
DRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGM
FNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL
ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIE
QNTKSPLFMGKVVNPTQK

Calculated Isoelectric Point:

5.37

Molecular Weight:

44569

Last Updated:

11/19/2010

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 11019 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-SERPINA1 PAGE

PAGE of Ag 11019 (with molecular weight standards in lane 1)

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com