RAD52 homolog (S. cerevisiae)


Background

Catalog Number:

CPTC-RAD52-1

Target Antigen:

RAD52 homolog (S. cerevisiae)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-RAD52-1 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-RAD52-1 Western blot

Western Blot using CPTC-RAD52-1 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-RAD52-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-RAD52-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-RAD52-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-RAD52-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-RAD52-2

Target Antigen:

RAD52 homolog (S. cerevisiae)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-RAD52-2 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-RAD52-2 Western blot

Western Blot using CPTC-RAD52-2 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-RAD52-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-RAD52-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-RAD52-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-RAD52-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-RAD52-3

Target Antigen:

RAD52 homolog (S. cerevisiae)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-RAD52-3 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-RAD52-3 Western blot

Western Blot using CPTC-RAD52-3 as primary Ab against PNMT (rAg 10468) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-RAD52-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-RAD52-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-RAD52-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-RAD52-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10468

Antigen Name:

RAD52 homolog (S. cerevisiae)

CPTC Name:

CPTC-RAD52

Keywords:

RAD52 homolog (S. cerevisiae); DNA repair protein RAD52 homolog; recombination protein RAD52; rhabdomyosarcoma antigen MU-RMS-40.23;

Function:

The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair.

Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by
promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase

Chromosomal Localization:

12p13-p12.2

Expression System:

E. Coli

NCBI Accession Number:

U12134.1

Swiss Prot Accession Number:

P43351

DNA Source:

DNASU - HsCD00022279

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

40130

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRL
GPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVD
LNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAV
TDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLE
PSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSS
AVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVT
HSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSS
RADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRT
TGNWESHRKSQDMKKRKYDPS

Native Sequence:

MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPE
YISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNN
GKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDG
LKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSV
EEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVE
SEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD
PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGN
WESHRKSQDMKKRKYDPS

Calculated Isoelectric Point:

8.49

Molecular Weight:

46441

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-RAD52 PAGE

PAGE of Ag 10468(with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com