protein tyrosine phosphatase, non-receptor type 6


Background

Catalog Number:

CPTC-PTPN6-1

Target Antigen:

protein tyrosine phosphatase, non-receptor type 6

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PTPN6-1 as primary Ab against PTPN6 (rAg 10766) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PTPN6-1 Western blot

Western Blot using CPTC-PTPN6-1 as primary Ab against PTPN6 (rAg 10766) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PTPN6-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-PTPN6-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-PTPN6-2

Target Antigen:

protein tyrosine phosphatase, non-receptor type 6

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

06/13/2017

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PTPN6-2 as primary Ab against PTPN6 (rAg 10766) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PTPN6-2 Western blot

Western Blot using CPTC-PTPN6-2 as primary Ab against PTPN6 (rAg 10766) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PTPN6-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-PTPN6-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PTPN6-2. Titer: 1:1400 Click image to enlarge

CPTC-PTPN6-2 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PTPN6-2. Titer: 1:1400

Background

Catalog Number:

CPTC-PTPN6-3

Target Antigen:

protein tyrosine phosphatase, non-receptor type 6

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PTPN6-3 as primary Ab against PTPN6 (rAg 10766) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PTPN6-3 Western blot

Western Blot using CPTC-PTPN6-3 as primary Ab against PTPN6 (rAg 10766) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PTPN6-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-PTPN6-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

10766

Antigen Name:

protein tyrosine phosphatase, non-receptor type 6

CPTC Name:

CPTC-PTPN6

Keywords:

PTP-1C; HCP; HCPH; SHP1; SHP-1; Hematopoietic cell protein-tyrosine phosphatase; Protein-tyrosine phosphatase 1C; Protein-tyrosine phosphatase SHP-1; SH-PTP1; hematopoietic cell phosphatase; tyrosine-protein phosphatase non-receptor type 6; SHP-1L; HPTP1C; PTP1C; EC 3.1.3.48

Function:

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. N-terminal part of this PTP contains two tandem Src homolog (SH2) domains, which
act as protein phospho-tyrosine binding domains, and mediate the interaction of this PTP with its substrates. This PTP
is expressed primarily in hematopoietic cells, and functions as an important regulator of multiple signaling pathways
in hematopoietic cells. This PTP has been shown to interact with, and dephosphorylate a wide spectrum of
phospho-proteins involved in hematopoietic cell signaling. Multiple alternatively spliced variants of this gene, which encode distinct isoforms, have been reported.

Plays a key role in hematopoiesis. This PTPase activity may directly link growth factor receptors and other
signaling proteins through protein-tyrosine phosphorylation. The SH2 regions may interact with other cellular
components to modulate its own phosphatase activity against interacting substrates. Together with MTUS1, induces UBE2V2 expression upon angiotensin II stimulation.

Protein tyrosine phosphatases (PTPs) are a group of enzymes that catalyze the removal of phosphate groups from tyrosine residues by the hydrolysis of phosphoric acid monoesters. They directly oppose the actions of kinases and phosphorylases and therefore play an integral role in many signal transduction pathways. PTPs are cysteine-dependent phosphatases that contain a conserved C[X]5R motif essential for enzymatic activity. PTPs are currently divided into five subtypes; tyrosine-specific phosphatases (e.g. PTP1B), dual specificity phosphatases (DSPs) (e.g. DUSP1), Cdc25 phosphatases (e.g. Cdc25A), myotubularin-related phosphatases (e.g. MTMR13) and low molecular weight phosphatases (e.g. PTPase A). Perturbations in PTP activity has been implicated in human diseases, including type II diabetes. PTPs have been identified as a negative regulator of the insulin signaling by dephosphorylating phosphotyrosine residues of insulin receptor kinase. In cancers, PTPs dephosphorylate EGFR, JAK2 and TYK2 kinases, promoting oncogenic transformation.

Chromosomal Localization:

12p13.31

Expression System:

E. Coli

NCBI Accession Number:

BC007667

Swiss Prot Accession Number:

P29350

DNA Source:

HsCD00003674

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG19

Extinction Coefficient:

86938

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMLSRGWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRV
GDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIH
LKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDF
VLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFK
KTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFW
EEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSN
IPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSR
VIVMTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTL
QVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPH
AGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQR
SGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAM
KNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

Native Sequence:

MLSRGWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQ
VTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKY
PLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLS
VLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTG
IEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEF
ESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPG
SDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIV
MTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVS
PLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGP
IIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGM
VQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNA
HAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

Calculated Isoelectric Point:

7.65

Molecular Weight:

67992

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-PTPN6 PAGE

PAGE of PTPN6 (rAg 10766) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com