Peroxiredoxin 4


Background

Catalog Number:

CPTC-PRDX4-1

RRID:

AB_1553754

Target Antigen:

Peroxiredoxin 4

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

08/03/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for PRDX4-1 Ab (632A11.1) using Biacore SPR method Click image to enlarge

CPTC-PRDX4-1 SPR

Result: Positive

Kinetic titration data for PRDX4-1 Ab (632A11.1) using Biacore SPR method


  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (522.7 KB)

CPTC-PRDX-1 evaluation by the Human Protein Atlas

Result: Negative

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-PRDX4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:5000
Click image to enlarge

CPTC-PRDX4-1 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-PRDX4-1 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:5000


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-1. Titer: 1:5000 Click image to enlarge

CPTC-PRDX4-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-1. Titer: 1:5000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PRDX4-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PRDX4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PRDX4-1 Protein Array

Result: Positive

Protein Array in which CPTC-PRDX4-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PRDX4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2). Click image to enlarge

CPTC-PRDX4-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-PRDX4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PRDX4-1 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PRDX4-1 Western Blot

Result: Positive

Western Blot using CPTC-PRDX4-1 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-PRDX4-2

RRID:

AB_1553756

Target Antigen:

Peroxiredoxin 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for PRDX4-2 Ab (632A14.1) using Biacore SPR method Click image to enlarge

CPTC-PRDX4-2 SPR

Result: Positive

Kinetic titration data for PRDX4-2 Ab (632A14.1) using Biacore SPR method


  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org). (152.2 KB)

CPTC-PRDX4-2 evaluation by the Human Protein Atlas

Result: Positive

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.proteinatlas.org).


  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-PRDX4-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
titer: 1:5000 Click image to enlarge

CPTC-PRDX4-2 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-PRDX4-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
titer: 1:5000


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-2. Titer: 1:5000 Click image to enlarge

CPTC-PRDX4-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PRDX4-2. Titer: 1:5000


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. 		

Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400 Click image to enlarge

CPTC-PRDX4-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PRDX4-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PRDX4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PRDX4-2 Protein Array

Result: Positive

Protein Array in which CPTC-PRDX4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PRDX4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2). Click image to enlarge

CPTC-PRDX4-2 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-PRDX4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PRDX4-2 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PRDX4-2 Western Blot

Result: Positive

Western Blot using CPTC-PRDX4-2 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-PRDX4-3

RRID:

AB_2300004

Target Antigen:

Peroxiredoxin 4

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (96.2 KB)

CPTC-PRDX4-3 Evaluation by Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-PRDX4-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-PRDX4-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum. 
Human assay: A-431 fixed with PFA, dilution: 1:5
Human assay: U-2 OS fixed with PFA, dilution: 1:5
Human assay: U-251 MG fixed with PFA, dilution: 1:5 Click image to enlarge

CPTC-PRDX4-3 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Human assay: A-431 fixed with PFA, dilution: 1:5
Human assay: U-2 OS fixed with PFA, dilution: 1:5
Human assay: U-251 MG fixed with PFA, dilution: 1:5


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PRDX4-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PRDX4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-PRDX4-3 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-PRDX4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500. Click image to enlarge

CPTC-PRDX4-3 Evaluation by Human Protein Atlas

Result: Presumed Positive (with additional bands)

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-PRDX4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2). Click image to enlarge

CPTC-PRDX4-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-PRDX4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag PRDX4 (NCI 10604) in (lane 2).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PRDX4-3 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PRDX4-3 Western Blot

Result: Positive

Western Blot using CPTC-PRDX4-3 as primary Ab against Ag 10604 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10604

Antigen Name:

Peroxiredoxin 4

CPTC Name:

CPTC-PRDX4

Keywords:

PRDX4; AOE37-2; EC 1.11.1.15; PRX-4; Prx-IV; OTTHUMP00000023056

Function:

The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family.
The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Chromosomal Localization:

Xp22.11

Expression System:

E. Coli

Accession Number:

BC016770

UniProt Accession Number:

Q13162

DNA Source:

HIP:HsCD00005539

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

37025

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKP
APYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDR
LEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQI
SKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQA
FQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Native Sequence:

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEE
CHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE
LKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
DSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLR
GLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWK
PGSETIIPDPAGKLKYFDKLN

Calculated Isoelectric Point:

5.53

Molecular Weight:

26844

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10604 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10604

PAGE of Ag 10604 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com