PRINT

Protein Phosphatase 2A

Antibody: CPTC-PP2A-1
Background

Catalog Number:

CPTC-PP2A-1

RRID:

AB_1553763

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for PP2A-1 Ab (622A1.1) using Biacore SPR method Click image to enlarge

CPTC-PP2A-1 SPR

Result: Positive

Kinetic titration data for PP2A-1 Ab (622A1.1) using Biacore SPR method


Characterization SOP Files

  CyTOF
Click to enlarge image Imaging mass cytometry on lung cancer tissue core using CPTC-PP2A-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (breast and endometrium) and cancer tissues (breast, colon, ovarian, lung, and prostate). Click image to enlarge

CPTC-PP2A-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on lung cancer tissue core using CPTC-PP2A-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (breast and endometrium) and cancer tissues (breast, colon, ovarian, lung, and prostate).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (652.0 KB)

CPTC-PP2A-1 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60

CPTC-PP2A-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-PP2A-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (652.0 KB)

CPTC-PP2A-1 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-PP2A-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-PP2A-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PP2A-1 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-1 Western Blot

Result: Positive

Western Blot using CPTC-PP2A-1 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-PP2A-2
Background

Catalog Number:

CPTC-PP2A-2

RRID:

AB_1553765

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/01/2022

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for PP2A-2 Ab (622A3.1) using Biacore SPR method Click image to enlarge

CPTC-PP2A-2 SPR

Result: Positive

Kinetic titration data for PP2A-2 Ab (622A3.1) using Biacore SPR method


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (696.1 KB)

CPTC-PP2A-2 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (696.1 KB)

CPTC-PP2A-2 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PP2A-2 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-2 Western Blot

Result: Positive

Western Blot using CPTC-PP2A-2 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-PP2A-3
Background

Catalog Number:

CPTC-PP2A-3

RRID:

AB_10571459

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on normal colon tissue core using CPTC-PP2A-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, placenta, prostate, colon, pancreas, breast, lung, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate). Click image to enlarge

CPTC-PP2A-3 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on normal colon tissue core using CPTC-PP2A-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, placenta, prostate, colon, pancreas, breast, lung, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (345.1 KB)

CPTC-PP2A-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (345.1 KB)

CPTC-PP2A-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PP2A-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PP2A-3 Protein Array

Result: Positive

Protein Array in which CPTC-PP2A-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PP2A-3 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-3 Western Blot

Result: Positive

Western Blot using CPTC-PP2A-3 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-PP2A-4
Background

Catalog Number:

CPTC-PP2A-4

RRID:

AB_2169787

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on normal prostate tissue core using CPTC-PP2A-4 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, spleen, prostate, colon, pancreas, breast, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate). Click image to enlarge

CPTC-PP2A-4 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on normal prostate tissue core using CPTC-PP2A-4 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, spleen, prostate, colon, pancreas, breast, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, lung, and prostate).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (888.6 KB)

CPTC-PP2A-4 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immunofluorescence - HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (888.6 KB)

CPTC-PP2A-4 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-4 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-PP2A-4 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-4 Western Blot

Result: Positive

Western Blot using CPTC-PP2A-4 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

[top]

Antigen: Protein Phosphatase 2A
Background

NCI Identification Number:

10501

Antigen Name:

Protein Phosphatase 2A

CPTC Name:

CPTC-PP2A

Aliases:

PP2A; PPP2CA; EC3.1.3.16; PP2A-alpha; PP2Ac; PP2CA; RP-C

Function:

PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Can dephosphorylate SV40 large T antigen and p53.
Dephosphorylates SV40 large T antigen, preferentially on serine residues 120, 123, 677, and perhaps 679. The C subunit was most active, followed by the AC form, which was more active than
the ABC form, and activity of all three forms was strongly stimulated by manganese, and to a lesser extent by magnesium. Dephosphorylation by the AC form, but not C or ABC form is inhibited by small T antigen

Chromosomal Localization:

5q31.1

Expression System:

E. Coli

Accession Number:

BC011605

UniProt Accession Number:

Q15257

DNA Source:

HIP:HsCD00004559

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

56505

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYAD
YIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQP
SRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNST
RIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQK
TYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNEN
HKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA
ECLEKFPVIQHFKFGSLLPIHPVTSG

Native Sequence:

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIG
FILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRF
GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRID
YGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYR
MEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKD
YMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL
EKFPVIQHFKFGSLLPIHPVTSG

Calculated Isoelectric Point:

5.89

Molecular Weight:

37047

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10501 with molecular weight standards in lane 1
Click image to enlarge

CPTC-PP2A (Ag 10501) PAGE

PAGE of Ag 10501 with molecular weight standards in lane 1

[top]

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]