Protein Phosphatase 2A


Background

Catalog Number:

CPTC-PP2A-1

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PP2A-1 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-1 Western Blot

Western Blot using CPTC-PP2A-1 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-PP2A-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-PP2A-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-PP2A-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for PP2A-1 Ab (622A1.1) using Biacore SPR method Click image to enlarge

CPTC-PP2A-1 SPR

Kinetic titration data for PP2A-1 Ab (622A1.1) using Biacore SPR method

Background

Catalog Number:

CPTC-PP2A-2

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/24/2012

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PP2A-2 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-2 Western Blot

Western Blot using CPTC-PP2A-2 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for PP2A-2 Ab (622A3.1) using Biacore SPR method Click image to enlarge

CPTC-PP2A-2 SPR

Kinetic titration data for PP2A-2 Ab (622A3.1) using Biacore SPR method

Background

Catalog Number:

CPTC-PP2A-3

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

01/26/2012

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PP2A-3 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-3 Western Blot

Western Blot using CPTC-PP2A-3 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PP2A-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PP2A-3 Protein Array

Protein Array in which CPTC-PP2A-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Background

Catalog Number:

CPTC-PP2A-4

Target Antigen:

Protein Phosphatase 2A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/26/2012

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PP2A-4 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PP2A-4 Western Blot

Western Blot using CPTC-PP2A-4 as primary Ab against Ag 10501 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PP2A-4 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Background

NCI Identification Number:

10501

Antigen Name:

Protein Phosphatase 2A

CPTC Name:

CPTC-PP2A

Keywords:

PP2A; PPP2CA; EC3.1.3.16; PP2A-alpha; PP2Ac; PP2CA; RP-C

Function:

PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Can dephosphorylate SV40 large T antigen and p53.
Dephosphorylates SV40 large T antigen, preferentially on serine residues 120, 123, 677, and perhaps 679. The C subunit was most active, followed by the AC form, which was more active than
the ABC form, and activity of all three forms was strongly stimulated by manganese, and to a lesser extent by magnesium. Dephosphorylation by the AC form, but not C or ABC form is inhibited by small T antigen

Chromosomal Localization:

5q31.1

Expression System:

E. Coli

NCBI Accession Number:

BC011605

Swiss Prot Accession Number:

Q15257

DNA Source:

HIP:HsCD00004559

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

56505

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYAD
YIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQP
SRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNST
RIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQK
TYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNEN
HKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA
ECLEKFPVIQHFKFGSLLPIHPVTSG

Native Sequence:

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIG
FILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRF
GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRID
YGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYR
MEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKD
YMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL
EKFPVIQHFKFGSLLPIHPVTSG

Calculated Isoelectric Point:

5.89

Molecular Weight:

37047

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click image to enlarge

CPTC-PP2A (Ag 10501) PAGE

PAGE of Ag 10501 with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com