Phenylethanolamine N-methyltransferase


Background

Catalog Number:

CPTC-PNMT-1

Target Antigen:

Phenylethanolamine N-methyltransferase

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PNMT-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-PNMT-1 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PNMT-1 Western blot

Western Blot using CPTC-PNMT-1 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-PNMT-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue

CPTC-PNMT-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-PNMT-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-PNMT-2

Target Antigen:

Phenylethanolamine N-methyltransferase

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PNMT-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PNMT-2 Western blot

Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-PNMT-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue

CPTC-PNMT-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-PNMT-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-PNMT-3

Target Antigen:

Phenylethanolamine N-methyltransferase

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PNMT-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PNMT-3 Western blot

Western Blot using CPTC-PNMT-2 as primary Ab against PNMT (rAg 10900) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-PNMT-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC Tissue

CPTC-PNMT-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-PNMT-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10900

Antigen Name:

Phenylethanolamine N-methyltransferase

CPTC Name:

CPTC-PNMT

Keywords:

EC 2.1.1.28; MGC34570; OTTHUMP00000164271; PENT; PNMTase

Function:

The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production.

Converts noradrenaline to adrenaline.

Chromosomal Localization:

17q21 - q22

Expression System:

E. Coli

NCBI Accession Number:

BC037246.1

Swiss Prot Accession Number:

P11086

DNA Source:

OB : MHS1010-7507627

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

45108

Buffers:

PBS

Expressed Sequence:

SNAMSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDL
CNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDI
TMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQL
RARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRA
LDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSG
YKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL

Native Sequence:

MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNP
NGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMT
DFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRAR
VKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDH
ITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKV
RDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL

Calculated Isoelectric Point:

5.73

Molecular Weight:

30.86

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10900(with molecular weight standards in lane 1)
Click image to enlarge

CPTC-PNMT PAGE

PAGE of Ag 10900(with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com