Phosphatidylethanolamine Binding Protein 1


Background

Catalog Number:

CPTC-PEBP1-1

Target Antigen:

Phosphatidylethanolamine Binding Protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/19/2013

Antigen Recognition(s):

SOP:

Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PEBP1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot

CPTC-PEBP1-1 Western blot

This antibody is not suitable for use in Western blots

Characterization SOP Files

Background

Catalog Number:

CPTC-PEBP1-2

Target Antigen:

Phosphatidylethanolamine Binding Protein 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-PEBP1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  Western Blot
Click to enlarge image Western Blot using CPTC-PEBP1-2 as primary Ab against PEBP1 (rAg 00060) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-PEBP1-2 Western blot

Western Blot using CPTC-PEBP1-2 as primary Ab against PEBP1 (rAg 00060) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-PEBP1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00060

Antigen Name:

Phosphatidylethanolamine Binding Protein 1

CPTC Name:

CPTC-PEBP1

Keywords:

PBP; RKIP; PEBP; HCNP; Prostatic Binding Protein; Neuropolypeptide H3; Prostatic-Binding Protein; Raf Kinase Inhibitor Protein; HCNPpp; PEBP-1; Hippocampal Cholinergic Neurostimulating Peptide; Phosphatidylethanolamine-Binding Protein 1; Raf Kinase Inhibitory Protein

Function:

Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation

Function: HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.

Chromosomal Localization:

12q24.23

Expression System:

Baculovirus

NCBI Accession Number:

NP_002558.1

Swiss Prot Accession Number:

P30086

DNA Source:

human ORFeome library

Immunogen:

Recombinant Full Length Protein

Vector Name:

11725-X06-635

Extinction Coefficient:

Buffers:

1x PBS, pH 7.2

Expressed Sequence:

MGSGSHHHHHHRSSITSLYKKVGENLYFQGPVDLSKWSGPLSLQEVDEQP
QHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDP
DAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYV
WLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQA
EWDDYVPKLYEQLSGKHHHHHH

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

25163

Last Updated:

11/13/2013

Links

Characterization Data

Gel

Click to enlarge image PAGE of PEBP1 (rAg 00060) with molecular weight standards in lane 1
Click image to enlarge

CPTC-PEBP1 PAGE

PAGE of PEBP1 (rAg 00060) with molecular weight standards in lane 1

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com