OTU domain, ubiquitin aldehyde binding 2


Background

Catalog Number:

CPTC-OTUB2-1

RRID:

AB_2617305

Target Antigen:

OTU domain, ubiquitin aldehyde binding 2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/25/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-OTUB2-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-OTUB2-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-OTUB2-1 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-OTUB2-1 Western blot

Result: Positive

Western Blot using CPTC-OTUB2-1 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-OTUB2-2

RRID:

AB_2617306

Target Antigen:

OTU domain, ubiquitin aldehyde binding 2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/25/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-OTUB2-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-OTUB2-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-OTUB2-2 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-OTUB2-2 Western blot

Result: Positive

Western Blot using CPTC-OTUB2-2 as primary Ab against PEBP1 (rAg 00054) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00054

Antigen Name:

OTU domain, ubiquitin aldehyde binding 2

CPTC Name:

CPTC-OTUB2

Keywords:

C14orf137; OTB2; OTU2; Deubiquitinating Enzyme OTUB2; Ubiquitin-Specific-Processing Protease OTUB2; OTU Domain-Containing Ubiquitin Aldehyde-Binding Protein 2; FLJ21916; MGC3102; Chromosome 14 Open Reading Frame 137; Otubain-2; Ubiquitin Thioesterase OTUB2; Ubiquitin-Specific Protease Otubain 2; EC 3.4.19.12

Function:

This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain.

Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains, with a preference for 'Lys-63'-linked polyubiquitin chains.

Chromosomal Localization:

14q32.12

Expression System:

E.coli

Accession Number:

NM_023112

UniProt Accession Number:

Q96DC9

DNA Source:

Imagenes

Immunogen:

Native Protein

Vector Name:

pNIC28-Bsa4

Extinction Coefficient:

Buffers:

NaP

Expressed Sequence:

MHHHHHHSSGVDLGTENLYFQSMETSFNLISEKCDILSILRDHPENRIYR
RKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERVL
QTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASD
HIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQ
ITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILY
AADKH

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

29679

Last Updated:

06/17/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of OTUB2 (rAg 00054) with molecular weight standards in lane 1
Click image to enlarge

CPTC-OTUB2 PAGE

PAGE of OTUB2 (rAg 00054) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com