OTU domain, ubiquitin aldehyde binding 1


Background

Catalog Number:

CPTC-OTUB1-1

RRID:

AB_2617302

Target Antigen:

OTU domain, ubiquitin aldehyde binding 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/03/2026

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on breast cancer tissue core using CPTC-OTUB1-1 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (prostate, liver, colon, appendix, pancreas, bone marrow, breast, kidney, lung, and placenta) and cancer tissues (breast, colon, prostate, lung, and ovarian). Click image to enlarge

CPTC-OTUB1-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on breast cancer tissue core using CPTC-OTUB1-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (prostate, liver, colon, appendix, pancreas, bone marrow, breast, kidney, lung, and placenta) and cancer tissues (breast, colon, prostate, lung, and ovarian).


  IHC HPA

CPTC-OTUB1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-OTUB1-1 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-OTUB1-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-OTUB1-1 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-OTUB1-1 Western blot

Result: Positive

Western Blot using CPTC-OTUB1-1 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-OTUB1-2

RRID:

AB_2617303

Target Antigen:

OTU domain, ubiquitin aldehyde binding 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

08/03/2026

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on ovarian cancer tissue core using CPTC-OTUB1-2 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (testis, liver, colon, endometrium, breast, kidney, lung, and placenta) and cancer tissues (breast, colon, prostate, lung and ovarian). Click image to enlarge

CPTC-OTUB1-2 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on ovarian cancer tissue core using CPTC-OTUB1-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (testis, liver, colon, endometrium, breast, kidney, lung, and placenta) and cancer tissues (breast, colon, prostate, lung and ovarian).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (191.7 KB)

CPTC-OTUB1-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-OTUB1-2. Titer: 1:30000 Click image to enlarge

CPTC-OTUB1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-OTUB1-2. Titer: 1:30000


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org).  The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol. 
Human assay: HeLa fixed with PFA, dilution: 1:2000
Human assay: MCF7 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-OTUB1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Human assay: HeLa fixed with PFA, dilution: 1:2000
Human assay: MCF7 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-OTUB1-2 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-OTUB1-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org).  Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500. Click image to enlarge

CPTC-OTUB1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-OTUB1-2 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-OTUB1-2 Western blot

Result: Positive

Western Blot using CPTC-OTUB1-2 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-OTUB1-3

RRID:

AB_2617304

Target Antigen:

OTU domain, ubiquitin aldehyde binding 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

08/25/2021

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA

CPTC-OTUB1-3 Evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-OTUB1-3 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-OTUB1-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-OTUB1-3 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-OTUB1-3 Western blot

Result: Positive

Western Blot using CPTC-OTUB1-3 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00017

Antigen Name:

OTU domain, ubiquitin aldehyde binding 1

CPTC Name:

CPTC-OTUB1

Aliases:

OTB1; OTU1; Deubiquitinating Enzyme OTUB1; Ubiquitin-Specific-Processing Protease OTUB1; OTU Domain-Containing Ubiquitin Aldehyde-Binding; FLJ20113; FLJ40710; Protein 1; OTU-Domain Ubal-Binding 1; Otubain-1; Ubiquitin Thioesterase OTUB1; Ubiquitin specific protease; EC 3.4.19.12; HOTU1; EC 3.1.2

Function:

The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants.

Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins and plays an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL, a crucial inductor of CD4 T-cell anergy. Isoform 1 destabilizes RNF128, leading to prevent anergy. In contrast, isoform 2 stabilizes RNF128 and promotes anergy.
Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a much lower preference compared to 'Lys-48'-linked ubiquitin.

Plays a key non-catalytic role in DNA repair regulation by inhibiting activity of RNF168, an E3 ubiquitin-protein ligase that promotes accumulation of 'Lys-63'-linked histone H2A and H2AX at DNA damage sites. Inhibits RNF168 independently of ubiquitin thioesterase activity by binding and inhibiting UBE2N/UBC13, the E2 partner of RNF168, thereby limiting spreading of 'Lys-63'-linked histone H2A and H2AX marks. Inhibition occurs by binding to free ubiquitin: free ubiquitin acts as an allosteric regulator that increases affinity for UBE2N/UBC13 and disrupts interaction with UBE2V1. The OTUB1-UBE2N/UBC13-free ubiquitin complex adopts a configuration that mimics a cleaved 'Lys48'-linked di-ubiquitin chain.

Chromosomal Localization:

11q13.1

Expression System:

E.coli

Accession Number:

NP_060140.2

UniProt Accession Number:

Q96FW1

DNA Source:

Imagenes

Immunogen:

Recombinant Full Length Protein

Vector Name:

pNIC28-Bsa4

Extinction Coefficient:

Buffers:

NaP

Expressed Sequence:

MHHHHHHSSGVDLGTENLYFQSMMAAEEPQQQKQEPLGSDSEGVNCLAYD
EAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHK
KYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVS
QGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRL
LTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQAL
SVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

33968

Last Updated:

06/17/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of OTUB1 (rAg 00017) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-OTUB1 PAGE

PAGE of OTUB1 (rAg 00017) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com