Catalog Number:
CPTC-OTUB1-1
RRID:
AB_2617302
Target Antigen:
OTU domain, ubiquitin aldehyde binding 1
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
08/03/2026
Antigen Recognition(s):
Recombinant Full-length, Endogenous
SOP:
Result: Positive
Imaging mass cytometry on breast cancer tissue core using CPTC-OTUB1-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (prostate, liver, colon, appendix, pancreas, bone marrow, breast, kidney, lung, and placenta) and cancer tissues (breast, colon, prostate, lung, and ovarian).
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Western Blot using CPTC-OTUB1-1 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Catalog Number:
CPTC-OTUB1-2
RRID:
AB_2617303
Target Antigen:
OTU domain, ubiquitin aldehyde binding 1
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
08/03/2026
Antigen Recognition(s):
Recombinant Full-length, Endogenous
SOP:
Result: Positive
Imaging mass cytometry on ovarian cancer tissue core using CPTC-OTUB1-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (testis, liver, colon, endometrium, breast, kidney, lung, and placenta) and cancer tissues (breast, colon, prostate, lung and ovarian).
Result: Positive
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: Positive
Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-OTUB1-2. Titer: 1:30000
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Human assay: HeLa fixed with PFA, dilution: 1:2000
Human assay: MCF7 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500.
Result: Positive
Western Blot using CPTC-OTUB1-2 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Catalog Number:
CPTC-OTUB1-3
RRID:
AB_2617304
Target Antigen:
OTU domain, ubiquitin aldehyde binding 1
Isotype:
IgG2a
Species:
Mouse Monoclonal Antibody
Last Updated:
08/25/2021
Antigen Recognition(s):
Recombinant Full-length
SOP:
Result: Negative
Results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Western Blot using CPTC-OTUB1-3 as primary Ab against OTUB1 (rAg 00017) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
NCI Identification Number:
00017
Antigen Name:
OTU domain, ubiquitin aldehyde binding 1
CPTC Name:
CPTC-OTUB1
Aliases:
OTB1; OTU1; Deubiquitinating Enzyme OTUB1; Ubiquitin-Specific-Processing Protease OTUB1; OTU Domain-Containing Ubiquitin Aldehyde-Binding; FLJ20113; FLJ40710; Protein 1; OTU-Domain Ubal-Binding 1; Otubain-1; Ubiquitin Thioesterase OTUB1; Ubiquitin specific protease; EC 3.4.19.12; HOTU1; EC 3.1.2
Function:
The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants.
Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins and plays an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL, a crucial inductor of CD4 T-cell anergy. Isoform 1 destabilizes RNF128, leading to prevent anergy. In contrast, isoform 2 stabilizes RNF128 and promotes anergy.
Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a much lower preference compared to 'Lys-48'-linked ubiquitin.
Plays a key non-catalytic role in DNA repair regulation by inhibiting activity of RNF168, an E3 ubiquitin-protein ligase that promotes accumulation of 'Lys-63'-linked histone H2A and H2AX at DNA damage sites. Inhibits RNF168 independently of ubiquitin thioesterase activity by binding and inhibiting UBE2N/UBC13, the E2 partner of RNF168, thereby limiting spreading of 'Lys-63'-linked histone H2A and H2AX marks. Inhibition occurs by binding to free ubiquitin: free ubiquitin acts as an allosteric regulator that increases affinity for UBE2N/UBC13 and disrupts interaction with UBE2V1. The OTUB1-UBE2N/UBC13-free ubiquitin complex adopts a configuration that mimics a cleaved 'Lys48'-linked di-ubiquitin chain.
Chromosomal Localization:
11q13.1
Expression System:
E.coli
Accession Number:
NP_060140.2
UniProt Accession Number:
Q96FW1
DNA Source:
Imagenes
Immunogen:
Recombinant Full Length Protein
Vector Name:
pNIC28-Bsa4
Extinction Coefficient:
Buffers:
NaP
Expressed Sequence:
MHHHHHHSSGVDLGTENLYFQSMMAAEEPQQQKQEPLGSDSEGVNCLAYD
EAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHK
KYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVS
QGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRL
LTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQAL
SVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
33968
Last Updated:
06/17/2020
PAGE of OTUB1 (rAg 00017) with molecular weight standards in lane 1.
Get it for free at Adobe.com