Ornithine Decarboxylase 1


Background

Catalog Number:

CPTC-ODC1-1

Target Antigen:

Ornithine Decarboxylase 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-ODC1-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-ODC1-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-ODC1-1 Click image to enlarge

CPTC-ODC1-1 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-ODC1-1


  NCI 60 Protein Array

CPTC-ODC1-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-ODC1-1 as primary Ab against Ag 10532(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-ODC1-1 Western Blot

Result: Positive

Western Blot Using CPTC-ODC1-1 as primary Ab against Ag 10532(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

Catalog Number:

CPTC-ODC1-2

Target Antigen:

Ornithine Decarboxylase 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-ODC1-2 for NCI60  Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK (red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:100
Click image to enlarge

CPTC-ODC1-2 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-ODC1-2 for NCI60 Cell Line Array at titer 1:500
0=NEGATIVE
1=WEAK (red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:100


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-ODC1-2. Titer: 1:100 Click image to enlarge

CPTC-ODC1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-ODC1-2. Titer: 1:100


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-ODC1-2 Click image to enlarge

CPTC-ODC1-2 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-ODC1-2


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-ODC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-ODC1-2 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-ODC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-ODC1-2 as primary Ab against Ag 10532(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-ODC1-2 Western Blot

Result: Positive

Western Blot Using CPTC-ODC1-2 as primary Ab against Ag 10532(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

Catalog Number:

CPTC-ODC1-3

Target Antigen:

Ornithine Decarboxylase 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for ODC1-3 Ab (615A3.1) using Biacore SPR method Click image to enlarge

CPTC-ODC1-3 SPR

Result: Positive

Kinetic titration data for ODC1-3 Ab (615A3.1) using Biacore SPR method


  IHC NCI60

CPTC-ODC1-3 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-ODC1-3 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-ODC1-3 Click image to enlarge

CPTC-ODC1-3 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-ODC1-3


  NCI 60 Protein Array

CPTC-ODC1-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot Using CPTC-ODC1-3 as primary Ab against Ag 10532(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3). Click image to enlarge

CPTC-ODC1-3 Western Blot

Result: Positive

Western Blot Using CPTC-ODC1-3 as primary Ab against Ag 10532(Lane 2). Also included are Molecular Weight markers (Lane 1) and mouse IgG positive control (Lane 3).


Background

NCI Identification Number:

10532

Antigen Name:

Ornithine Decarboxylase 1

CPTC Name:

CPTC-ODC1

Keywords:

ODC1; EC 4.1.1.17; ODC

Function:

This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter.

Chromosomal Localization:

2p25

Expression System:

E. Coli

NCBI Accession Number:

BC025296

Swiss Prot Accession Number:

P11926

DNA Source:

HIP:HsCD00005772

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

53205

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGD
ILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQL
VQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHP
KAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFH
VGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLK
FEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVL
KEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPD
EKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTF
NGFQRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVSCAWESGM
KRHRAACASASINV

Native Sequence:

MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILK
KHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQS
LGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAK
LVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGS
GCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEE
ITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY
YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGF
QRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVSCAWESGMKRH
RAACASASINV

Calculated Isoelectric Point:

5.1

Molecular Weight:

51420

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10532 with molecular weight standards
Click image to enlarge

Ag 10532 Gel

PAGE of Ag 10532 with molecular weight standards

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com