Nucleoside Diphosphate Kinase A (nm23-H1)


Background

Catalog Number:

CPTC-NME1-1

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NME1-1 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-1 Western Blot

Western Blot using CPTC-NME1-1 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-NME1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity between NME1 and NME2 Click image to enlarge

Cross Reactivity Studies

This table shows the cross reactivity between NME1 and NME2

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NME1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-NME1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-NME1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-NME1-2

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2013

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NME1-2 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-2 Western Blot

Western Blot using CPTC-NME1-2 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-NME1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity data for NME1 and NME2. Click image to enlarge

Cross Reactivity Studies

This table shows the cross reactivity data for NME1 and NME2.

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-NME1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-NME1-2 NCI 60 Protein Array

Protein Array in which CPTC-NME1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-NME1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50
Click image to enlarge

CPTC-NME1-2 IHC NCI60

Immunohistochemistry of CPTC-NME1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:50

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-NME1-2. Titer: 1:50
Click image to enlarge

CPTC-NME1-2 IHC Tissue

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-NME1-2. Titer: 1:50

Background

Catalog Number:

CPTC-NME1-3

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NME1-3 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-3 Western Blot

Western Blot using CPTC-NME1-3 as primary Ab against NME1 (Ag 10263) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-NME1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity between NME1 and NME2. Click image to enlarge

Cross Reactivity Studies

This table shows the cross reactivity between NME1 and NME2.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NME1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-NME1-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-NME1-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-NME1-4

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/27/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NME1-4 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-4 Western blot

Western Blot using CPTC-NME1-4 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NME1-4 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-NME1-4 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-NME1-4 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-NME1-4 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-NME1-5

Target Antigen:

Nucleoside Diphosphate Kinase A (nm23-H1)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/27/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NME1-5 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NME1-5 Western blot

Western Blot using CPTC-NME1-5 as primary Ab against NME1 (rAg 10263) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NME1-5 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-NME1-5 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-NME1-5 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-NME1-5 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10263

Antigen Name:

Nucleoside Diphosphate Kinase A (nm23-H1)

CPTC Name:

CPTC-NME1

Keywords:

NME1; AWD; GAAD; NDPK-A; NDPKA; NM23; NM23-H1; nm23-H1; EC 2.7.4.6; OTTHUMP00000174772

Function:

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A'(encoded by this gene) and 'B'(encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Major role in the synthesis of nucleoside triphosphates other than ATP.

Chromosomal Localization:

17q21.33

Expression System:

E. Coli

NCBI Accession Number:

BC000293

Swiss Prot Accession Number:

P15531

DNA Source:

HIP : HsCD00001887

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

22523

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDL
LKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPA
DSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQ
NWIYE

Native Sequence:

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKE
HYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSK
PGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWI
YE

Calculated Isoelectric Point:

5.83

Molecular Weight:

17421

Last Updated:

11/14/2012

Links

Characterization Data

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com