neural precursor cell expressed, developmentally down-regulated 4 isoform 1


Background

Catalog Number:

CPTC-NEDD4-1

Target Antigen:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NEDD4-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-NEDD4-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-NEDD4-1 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NEDD4-1 Western blot

Result: Positive

Western Blot using CPTC-NEDD4-1 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-NEDD4-2

Target Antigen:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NEDD4-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-NEDD4-2 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-NEDD4-2 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NEDD4-2 Western blot

Result: Positive

Western Blot using CPTC-NEDD4-2 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-NEDD4-3

Target Antigen:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NEDD4-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-NEDD4-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-NEDD4-3 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NEDD4-3 Western blot

Result: Positive

Western Blot using CPTC-NEDD4-3 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00011

Antigen Name:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

CPTC Name:

CPTC-NEDD4

Keywords:

neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitinprotein ligase; NEDD4-1; RPF1; KIAA0093; Cell proliferation-inducing gene 53 protein; Neural precursor cell expressed developmentally down-regulated protein 4; NEDD-4; MGC176705; neural precursor cell expressed, developmentally down-regulated 4; E3 ubiquitin-protein ligase NEDD4; receptor-potentiating factor 1; EC 6.3.2.

Function:

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a
thioester and then directly transfers the ubiquitin to targeted substrates. Involved in the pathway leading to the
degradation of VEGFR-2/KDFR, independently of its ubiquitin-ligase activity. Monoubiquitinates IGF1R at multiple sites, thus leading to receptor internalization and degradation in lysosomes. Ubiquitinates FGFR1, leading to receptor
internalization and degradation in lysosomes. According to PubMed:18562292 the direct link between NEDD4 and PTEN
regulation through polyubiquitination described in PubMed:17218260 is questionable. Involved in ubiquitination of ERBB4 intracellular domain E4ICD. Involved in the budding of many viruses. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. Ubiquitinates
TNK2 and regulates EGF-induced degradation of EGFR and TNF2.

Chromosomal Localization:

15q21.3

Expression System:

E. coli

NCBI Accession Number:

NM_006154

Swiss Prot Accession Number:

P46934

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS, pH 7.4

Expressed Sequence:

mhhhhhhssgrenlyfqgMATCAVEVFGLLEDEENSRIVRVRVIAGIGLA
KKDILGASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHP
QQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLH
PRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAAC
HLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAE
NGNIQLQAQRAFTTRRQISEETESVDNQESSENWEIIREDEATMYSSQAF
PSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAY
TFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQ
ATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQGFLPKGWEVRHA
PNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEER
THTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRK
LKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKG
LDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHL
SYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYY
NSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEY
IYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGD
VDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSR
VPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEEL
WDKLQMAIENTQG

Native Sequence:

Calculated Isoelectric Point:

5.9

Molecular Weight:

105822

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of NEDD4 (Ag 00011) with molecular weight standards in lane 1
Click image to enlarge

CPTC-NEDD4 PAGE

PAGE of NEDD4 (Ag 00011) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com