neural precursor cell expressed, developmentally down-regulated 4 isoform 1


Background

Catalog Number:

CPTC-NEDD4-1

Target Antigen:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NEDD4-1 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NEDD4-1 Western blot

Western Blot using CPTC-NEDD4-1 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NEDD4-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NEDD4-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-NEDD4-2

Target Antigen:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NEDD4-2 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NEDD4-2 Western blot

Western Blot using CPTC-NEDD4-2 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NEDD4-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NEDD4-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-NEDD4-3

Target Antigen:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NEDD4-3 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NEDD4-3 Western blot

Western Blot using CPTC-NEDD4-3 as primary Ab against NEDD4 (rAg 00011) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NEDD4-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NEDD4-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00011

Antigen Name:

neural precursor cell expressed, developmentally down-regulated 4 isoform 1

CPTC Name:

CPTC-NEDD4

Keywords:

neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitinprotein ligase; NEDD4-1; RPF1; KIAA0093; Cell proliferation-inducing gene 53 protein; Neural precursor cell expressed developmentally down-regulated protein 4; NEDD-4; MGC176705; neural precursor cell expressed, developmentally down-regulated 4; E3 ubiquitin-protein ligase NEDD4; receptor-potentiating factor 1; EC 6.3.2.

Function:

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a
thioester and then directly transfers the ubiquitin to targeted substrates. Involved in the pathway leading to the
degradation of VEGFR-2/KDFR, independently of its ubiquitin-ligase activity. Monoubiquitinates IGF1R at multiple sites, thus leading to receptor internalization and degradation in lysosomes. Ubiquitinates FGFR1, leading to receptor
internalization and degradation in lysosomes. According to PubMed:18562292 the direct link between NEDD4 and PTEN
regulation through polyubiquitination described in PubMed:17218260 is questionable. Involved in ubiquitination of ERBB4 intracellular domain E4ICD. Involved in the budding of many viruses. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. Ubiquitinates
TNK2 and regulates EGF-induced degradation of EGFR and TNF2.

Chromosomal Localization:

15q21.3

Expression System:

E. coli

NCBI Accession Number:

NM_006154

Swiss Prot Accession Number:

P46934

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS, pH 7.4

Expressed Sequence:

mhhhhhhssgrenlyfqgMATCAVEVFGLLEDEENSRIVRVRVIAGIGLA
KKDILGASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHP
QQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLH
PRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAAC
HLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAE
NGNIQLQAQRAFTTRRQISEETESVDNQESSENWEIIREDEATMYSSQAF
PSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAY
TFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQ
ATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQGFLPKGWEVRHA
PNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEER
THTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRK
LKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKG
LDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHL
SYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYY
NSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEY
IYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGD
VDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSR
VPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEEL
WDKLQMAIENTQG

Native Sequence:

Calculated Isoelectric Point:

5.9

Molecular Weight:

105822

Last Updated:

06/10/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-NEDD4 PAGE

PAGE of NEDD4 (Ag 00011) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com