Nuclear receptor co-repressor 1


Background

Catalog Number:

CPTC-NCOR1-1

Target Antigen:

Nuclear receptor co-repressor 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NCOR1-1 as primary Ab against NCOR1 (rAg 00009) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NCOR1-1 Western blot

Western Blot using CPTC-NCOR1-1 as primary Ab against NCOR1 (rAg 00009) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NCOR1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NCOR1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-NCOR1-2

Target Antigen:

Nuclear receptor co-repressor 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

07/23/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NCOR1-2 as primary Ab against NCOR1 (rAg 00009) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NCOR1-2 Western blot

Western Blot using CPTC-NCOR1-2 as primary Ab against NCOR1 (rAg 00009) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NCOR1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NCOR1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-NCOR1-3

Target Antigen:

Nuclear receptor co-repressor 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

05/22/2014

Antigen Recognition(s):

Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-NCOR1-3 as primary Ab against NCOR1 (rAg 00009) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-NCOR1-3 Western blot

Western Blot using CPTC-NCOR1-3 as primary Ab against NCOR1 (rAg 00009) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-NCOR1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-NCOR1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00009

Antigen Name:

Nuclear receptor co-repressor 1

CPTC Name:

CPTC-NCOR1

Keywords:

nuclear receptor corepressor 1; N-CoR; TRAC1; hN-CoR; KIAA1047; N-CoR1; MGC104216; hCIT529I10; thyroid hormone- and retinoic acid receptor-associated corepressor 1

Function:

This gene encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast
protein Sin3p. This gene is located between the Charcot-Marie-Tooth and Smith-Magenis syndrome critical regions on chromosome 17. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 17 and 20.

Mediates transcriptional repression by certain nuclear receptors. Part of a complex which promotes histone
deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription
factors

Chromosomal Localization:

17p11.2

Expression System:

E. coli

NCBI Accession Number:

NM_006311

Swiss Prot Accession Number:

O75376

DNA Source:

Mammalian Gene Collection (MGC)

Immunogen:

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS pH 7.4

Expressed Sequence:

MHHHHHHSSGRENLYFQGTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIA
KMVGTKSEAQCKNFYFNYKRRHNLDNLLQ

Native Sequence:

Calculated Isoelectric Point:

8.3

Molecular Weight:

9377

Last Updated:

12/03/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-NCOR1 PAGE

PAGE of NCOR1 (Ag 00009) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com