Mucin 17 domain CRD1-L-CRD2


Background

Catalog Number:

CPTC-MUC17 CRD1 L CRD2-1

RRID:

AB_2722093

Target Antigen:

Mucin 17 domain CRD1-L-CRD2

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

11/13/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-MUC17 CRD1-L-CRD2 -1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-MUC17 CRD1-L-CRD2-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MUC17-CRD1-L-CRD2-1 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MUC17 CRD1-L-CRD2-1 Western blot

Result: Positive

Western Blot using CPTC-MUC17-CRD1-L-CRD2-1 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-MUC17 CRD1 L CRD2-2

RRID:

AB_2617293

Target Antigen:

Mucin 17 domain CRD1-L-CRD2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/13/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-MUC17 CRD1-L-CRD2 -2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-MUC17 CRD1-L-CRD2-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MUC17-CRD1-L-CRD2-2 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MUC17 CRD1-L-CRD2-2 Western blot

Result: Positive

Western Blot using CPTC-MUC17-CRD1-L-CRD2-2 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-MUC17 CRD1 L CRD2-3

RRID:

AB_2722094

Target Antigen:

Mucin 17 domain CRD1-L-CRD2

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

11/13/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-MUC17 CRD1-L-CRD2 -3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-MUC17 CRD1-L-CRD2-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MUC17-CRD1-L-CRD2-3 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MUC17 CRD1-L-CRD2-3 Western blot

Result: Positive

Western Blot using CPTC-MUC17-CRD1-L-CRD2-3 as primary Ab against MUC17-CRD1-L-CRD2 (rAg 00006) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00006

Antigen Name:

Mucin 17 domain CRD1-L-CRD2

CPTC Name:

CPTC-MUC17 CRD1-L-CRD2

Keywords:

intestinal membrane mucin MUC17; mucin 17; small intestinal mucin-3; secreted mucin MUC17; MUC-17; MUC3

Function:

MUC17 comprises of a signal peptide, a large central tandemly repeated central domain (TR), two EGF-like domains, a SEA (sea urchin sperm protein, enterokinase, and agrin) domain, a transmembrane domain (TM) and an 80 amino acid cytoplasmic tail (Cyt).

Human MUC17 and mouse homolog of human MUC17 i.e. Muc3 are highly expressed in the gallbladder, intestine, and colon and are localized in the upper villi of the intestine and on the surface and upper crypt cells of the colon. The expression of MUC17 is down regulated in ulcerative colitis (UC) and Crohn's disease (CD) as compared to normal controls. In addition to the inflammatory bowel disease (IBD), there is significant downregulation of MUC17 expression in the neoplastic conditions of colon such as hyperplastic polyps, tubular and tubulovillous adenoma and colon adenocarcinoma.

The extracellular regions contains two EGF-like Cys-rich domains (CRD1 and CRD2) connected by an intervening linker segment with SEA module (L), that may function to stimulate intestinal cell restitution.

Chromosomal Localization:

7q22

Expression System:

E.coli

NCBI Accession Number:

NM_001040105

UniProt Accession Number:

Q685J3

DNA Source:

MUC17-CRD1-L-CRD2 coding region was amplified from human intestinal cDNA

Immunogen:

Recombinant Domain

Vector Name:

pET28

Extinction Coefficient:

28780

Buffers:

50mM Tris (pH 8.2) buffer

Expressed Sequence:

RTTSRGCTTSASTLSATSTPHTSTSVTTRPVTPSSESSRPSTITSHTIPP
TFPPAHSSTPPTTSASSTTVNPEAVTTMTTRTKPSTRTTSFPTVTTTAVP
TNTTIKSNPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLY
YGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEF
KQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTV
LDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPE
EDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSG
PQCLCVTTETHWYSGETCNQGTQKSV4390EHHHHHH

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

42062

Last Updated:

11/26/2012

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com