Moesin


Background

Catalog Number:

CPTC-MSN-1

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

04/09/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-1 Western blot

Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-1 Cell Lysate blot

Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-1 Protein Array

Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC HPA
Download CPTC-MSN-1.pdf (91.1 KB)

CPTC-MSN-1 Evaluation

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-MSN-2

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

04/09/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-2 Western blot

Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-2 Cell Lysate blot

Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-2 Protein Array

Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC HPA
Download CPTC-MSN-2.pdf (103.2 KB)

CPTC-MSN-2 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-MSN-3

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-3 Western blot

Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-3 Cell Lysate Western blot

Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-3 Protein Array

Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000 Click image to enlarge

CPTC-MSN-3 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000

  IHC HPA
Download CPTC-MSN-3.pdf (110.7 KB)

CPTC-MSN-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10782

Antigen Name:

Moesin

CPTC Name:

CPTC-MSN

Keywords:

Function:

Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons.
Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.

Chromosomal Localization:

Xq11.2 - q12

Expression System:

E. Coli

NCBI Accession Number:

BC017293

Swiss Prot Accession Number:

P26038

DNA Source:

DNASU - HsCD00041631

Immunogen:

Recombinant Full Length Protein

Vector Name:

MCSG7

Extinction Coefficient:

57933

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGL
QYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDI
TQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYL
AGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQD
LEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRN
ISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
DTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEEL
MERLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAE
EAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQ
KAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRAD
AMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAE
NMRLGRDKYKTLRQIRQGNTKQRIDEFESM

Native Sequence:

MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQ
DTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQR
LFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGD
KLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEM
YGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISF
NDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER
LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAK
EALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQ
MVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMA
KDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMR
LGRDKYKTLRQIRQGNTKQRIDEFESM

Calculated Isoelectric Point:

6.07

Molecular Weight:

68092

Last Updated:

11/14/2012

Links

Characterization Data

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com