PRINT

Moesin

Antibody: CPTC-MSN-1
Background

Catalog Number:

CPTC-MSN-1

RRID:

AB_10658735

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on breast cancer tissue core using CPTC-MSN-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, prostate, colon, ovarian, and lung). Click image to enlarge

CPTC-MSN-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on breast cancer tissue core using CPTC-MSN-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, prostate, colon, ovarian, and lung).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (91.1 KB)

CPTC-MSN-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000 Human assay: U-2 OS fixed with PFA, dilution: 1:2000 Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-MSN-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-1 Protein Array

Result: Positive

Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500. Click image to enlarge

CPTC-MSN-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-1 Cell Lysate blot

Result: Positive

Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-1 Western blot

Result: Positive

Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-MSN-2
Background

Catalog Number:

CPTC-MSN-2

RRID:

AB_10659456

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on normal spleen tissue core using CPTC-MSN-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, prostate, colon, ovarian, and lung). Click image to enlarge

CPTC-MSN-2 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on normal spleen tissue core using CPTC-MSN-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, prostate, colon, ovarian, and lung).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (103.2 KB)

CPTC-MSN-2 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000 Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-MSN-2 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-2 Protein Array

Result: Positive

Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-2 Cell Lysate blot

Result: Positive

Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-2 Western blot

Result: Positive

Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-MSN-3
Background

Catalog Number:

CPTC-MSN-3

RRID:

AB_10659794

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  CyTOF
Click to enlarge image Imaging mass cytometry on ovarian cancer tissue core using CPTC-MSN-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, prostate, colon, ovarian, and lung). Click image to enlarge

CPTC-MSN-3 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on ovarian cancer tissue core using CPTC-MSN-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, prostate, colon, pancreas, breast, lung, testis, endometrium, and appendix) and cancer tissues (breast, prostate, colon, ovarian, and lung).


Characterization SOP Files

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (110.7 KB)

CPTC-MSN-3 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000 Click image to enlarge

CPTC-MSN-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000 Human assay: U-2 OS fixed with PFA, dilution: 1:2000 Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-MSN-3 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-3 Protein Array

Result: Positive

Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-MSN-3 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-3 Western blot

Result: Positive

Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

[top]

Antigen: Moesin
Background

NCI Identification Number:

10782

Antigen Name:

Moesin

CPTC Name:

CPTC-MSN

Aliases:

Moesin; Membrane-Organizing Extension Spike Protein; Epididymis Luminal Protein 70; HEL70; IMD50

Function:

Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons.
Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.

Chromosomal Localization:

Xq11.2 - q12

Expression System:

E. Coli

Accession Number:

BC017293

UniProt Accession Number:

P26038

DNA Source:

DNASU - HsCD00041631

Immunogen:

Recombinant Full Length Protein

Vector Name:

MCSG7

Extinction Coefficient:

57933

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGL
QYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDI
TQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYL
AGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQD
LEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRN
ISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
DTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEEL
MERLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAE
EAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQ
KAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRAD
AMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAE
NMRLGRDKYKTLRQIRQGNTKQRIDEFESM

Native Sequence:

MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQ
DTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQR
LFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGD
KLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEM
YGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISF
NDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER
LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAK
EALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQ
MVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMA
KDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMR
LGRDKYKTLRQIRQGNTKQRIDEFESM

Calculated Isoelectric Point:

6.07

Molecular Weight:

68092

Last Updated:

06/17/2020

Links

Characterization Data

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]