Moesin


Background

Catalog Number:

CPTC-MSN-1

RRID:

AB_10658735

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (91.1 KB)

CPTC-MSN-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-MSN-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-1 Protein Array

Result: Positive

Protein Array in which CPTC-MSN-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500. Click image to enlarge

CPTC-MSN-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-1 Cell Lysate blot

Result: Positive

Western Blot using CPTC-MSN-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-1 Western blot

Result: Positive

Western Blot using CPTC-MSN-1 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

Catalog Number:

CPTC-MSN-2

RRID:

AB_10659456

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (103.2 KB)

CPTC-MSN-2 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane. 
Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-MSN-2 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-2 Protein Array

Result: Positive

Protein Array in which CPTC-MSN-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-2 Cell Lysate blot

Result: Positive

Western Blot using CPTC-MSN-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-2 Western blot

Result: Positive

Western Blot using CPTC-MSN-2 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

Catalog Number:

CPTC-MSN-3

RRID:

AB_10659794

Target Antigen:

Moesin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (110.7 KB)

CPTC-MSN-3 Evaluation by Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000 Click image to enlarge

CPTC-MSN-3 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-MSN-3. Titer: 1:15000


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-MSN-3 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-MSN-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-MSN-3 Protein Array

Result: Positive

Protein Array in which CPTC-MSN-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-MSN-3 Evaluation by Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:500


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4). Click image to enlarge

CPTC-MSN-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-MSN-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag MSN (NCI 10782) in (lane 4).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-MSN-3 Western blot

Result: Positive

Western Blot using CPTC-MSN-3 as primary Ab against rAg 10782 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

NCI Identification Number:

10782

Antigen Name:

Moesin

CPTC Name:

CPTC-MSN

Aliases:

Moesin; Membrane-Organizing Extension Spike Protein; Epididymis Luminal Protein 70; HEL70; IMD50

Function:

Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons.
Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.

Chromosomal Localization:

Xq11.2 - q12

Expression System:

E. Coli

Accession Number:

BC017293

UniProt Accession Number:

P26038

DNA Source:

DNASU - HsCD00041631

Immunogen:

Recombinant Full Length Protein

Vector Name:

MCSG7

Extinction Coefficient:

57933

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGL
QYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDI
TQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYL
AGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQD
LEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRN
ISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
DTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEEL
MERLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAE
EAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQ
KAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRAD
AMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAE
NMRLGRDKYKTLRQIRQGNTKQRIDEFESM

Native Sequence:

MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQ
DTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQR
LFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGD
KLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEM
YGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISF
NDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER
LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAK
EALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQ
MVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMA
KDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMR
LGRDKYKTLRQIRQGNTKQRIDEFESM

Calculated Isoelectric Point:

6.07

Molecular Weight:

68092

Last Updated:

06/17/2020

Links

Characterization Data

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com