Multiple endocrine neoplasia I


Background

Catalog Number:

CPTC-MEN1-1

Target Antigen:

Multiple endocrine neoplasia I

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

06/12/2014

Antigen Recognition(s):

Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-MEN1-1 as primary Ab against MEN1 (rAg 00058) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MEN1-1 Western blot

Western Blot using CPTC-MEN1-1 as primary Ab against MEN1 (rAg 00058) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-MEN1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-MEN1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00058

Antigen Name:

Multiple endocrine neoplasia I

CPTC Name:

CPTC-MEN1

Keywords:

SCG2; MEAI; Menin

Function:

Chromosomal Localization:

11q13

Expression System:

E. coli

NCBI Accession Number:

NP_000235.2

Swiss Prot Accession Number:

O00255

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS pH 7.4

Expressed Sequence:

MHHHHHHSSGRENLYFQGMGLKAAQKTLFPLRSIDDVVRLFAAELGREEP
DLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVAD
LSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRS
YFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHA
WVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDR
KMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGN
LADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNR
NVREALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASL
LEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVL
HVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRG
PRRESKPEEPPPPKKPALDKGLGTGQGAVSGP

Native Sequence:

Calculated Isoelectric Point:

5.6

Molecular Weight:

59520

Last Updated:

10/25/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-MEN1 PAGE

PAGE of MEN1 (rAg 00058) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com