Multiple endocrine neoplasia I


Background

Catalog Number:

CPTC-MEN1-1

Target Antigen:

Multiple endocrine neoplasia I

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-MEN1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-MEN1-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-MEN1-1 as primary Ab against MEN1 (rAg 00058) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-MEN1-1 Western blot

Result: Positive

Western Blot using CPTC-MEN1-1 as primary Ab against MEN1 (rAg 00058) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00058

Antigen Name:

Multiple endocrine neoplasia I

CPTC Name:

CPTC-MEN1

Keywords:

SCG2; MEAI; Menin

Function:

Chromosomal Localization:

11q13

Expression System:

E. coli

NCBI Accession Number:

NP_000235.2

Swiss Prot Accession Number:

O00255

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS pH 7.4

Expressed Sequence:

MHHHHHHSSGRENLYFQGMGLKAAQKTLFPLRSIDDVVRLFAAELGREEP
DLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVAD
LSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRS
YFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHA
WVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDR
KMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGN
LADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNR
NVREALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASL
LEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVL
HVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRG
PRRESKPEEPPPPKKPALDKGLGTGQGAVSGP

Native Sequence:

Calculated Isoelectric Point:

5.6

Molecular Weight:

59520

Last Updated:

11/14/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of MEN1 (rAg 00058) with molecular weight standards in lane 1
Click image to enlarge

CPTC-MEN1 PAGE

PAGE of MEN1 (rAg 00058) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com