LIN-28 homolog A


Background

Catalog Number:

CPTC-LIN28A-1

Target Antigen:

LIN-28 homolog A

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-LIN28A-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-LIN28A-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Background

NCI Identification Number:

00059

Antigen Name:

LIN-28 homolog A

CPTC Name:

CPTC-LIN28A

Keywords:

LIN28; CSDD1; ZCCHC1; LIN-28; Zinc Finger CCHC Domain-Containing Protein 1; FLJ12457; Lin-28 Homolog (C. Elegans); Lin-28A; Protein Lin-28 Homolog A; RNA-Binding Protein LIN-28; Zinc Finger, CCHC Domain Containing 1

Function:

Acts as a 'translational enhancer', driving specific mRNAs to polysomes and thus increasing the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in stabilizing the mRNAs. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression (By similarity). Acts as a suppressor of microRNA (miRNA) biogenesis by specifically binding the precursor let-7 (pre-let-7), a miRNA precursor. Acts by binding pre-let-7 and recruiting ZCCHC11/TUT4 uridylyltransferase, leading to the terminal uridylation of pre-let-7. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 in embryonic stem (ES) cells contributes to the maintenance of ES cells. In contrast, LIN28A down-regulation in neural stem cells by miR-125, allows the processing of pre-let-7. Specifically recognizes the 5'-GGAG-3' motif in the terminal loop of pre-let-7. Also recognizes and binds non pre-let-7 pre-miRNAs that contain the 5'-GGAG-3' motif in the terminal loop, leading to their terminal uridylation and subsequent degradation.

Chromosomal Localization:

1p36.11

Expression System:

E. coli

NCBI Accession Number:

NP_078950.1

Swiss Prot Accession Number:

Q9H9Z2

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS pH 7.4

Expressed Sequence:

mhhhhhhssgrenlyfqgMGSVSNQQFAGGCAKAAEEAPEEAPEDAARAA
DEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHME
GFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKR
RSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
SAQGKPTYFREEEEEIHSPTLLPEAQN

Native Sequence:

Calculated Isoelectric Point:

7.9

Molecular Weight:

24936

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of LIN28A (rAg 00059) with molecular weight standards in lane 1
Click image to enlarge

CPTC-LIN28A PAGE

PAGE of LIN28A (rAg 00059) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com