Kinesin-like protein KIF2C


Background

Catalog Number:

CPTC-KIF2C-1

Target Antigen:

Kinesin-like protein KIF2C

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-KIF2C-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-KIF2C-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KIF2C-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-KIF2C-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-KIF2C-1 as primary Ab against KIF2C (rAg 11188) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-KIF2C-1 Western blot

Result: Positive

Western Blot using CPTC-KIF2C-1 as primary Ab against KIF2C (rAg 11188) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-KIF2C-2

Target Antigen:

Kinesin-like protein KIF2C

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-KIF2C-2 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-KIF2C-2 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KIF2C-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-KIF2C-2 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-KIF2C-2 as primary Ab against KIF2C (rAg 11188) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-KIF2C-2 Western blot

Result: Positive

Western Blot using CPTC-KIF2C-2 as primary Ab against KIF2C (rAg 11188) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-KIF2C-3

Target Antigen:

Kinesin-like protein KIF2C

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-KIF2C-3 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-KIF2C-3 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KIF2C-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-KIF2C-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-KIF2C-3 as primary Ab against KIF2C (rAg 11188) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-KIF2C-3 Western blot

Result: Positive

Western Blot using CPTC-KIF2C-3 as primary Ab against KIF2C (rAg 11188) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

11188

Antigen Name:

Kinesin-like protein KIF2C

CPTC Name:

CPTC-KIF2C

Keywords:

kinesin family member 2C; MCAK; KNSL6; Kinesin-like protein 6; Mitotic centromere-associated kinesin; kinesin-like 6 (mitotic centromere-associated kinesin); kinesin-like 6; kinesin-like protein KIF2C

Function:

The protein encoded by this gene is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein is important for anaphase chromosome segregation and may be required to coordinate the onset of
sister centromere separation.

Promotes ATP-dependent removal of tubulin dimers from microtubules. Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis.

Chromosomal Localization:

1p34.1

Expression System:

E. Coli

NCBI Accession Number:

BC014924

Swiss Prot Accession Number:

Q99661

DNA Source:

DNASU - HsCD00002321

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

33390

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAE
GGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVN
SKIPAPKESLRSRSTRMSTVSELRITAQENDMEVELPAAANSRKQFSVPP
APTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSCLVKE
VEKMKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFRATLECHP
LTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLK
VDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAY
GQTGSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEV
YVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIK
MIDMGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNE
RGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQV
LRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGE
QLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEK
AMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSAL
RDVIKALRLAMQLEEQASRQISSKKRPQ

Native Sequence:

MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGA
TKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
PAPKESLRSRSTRMSTVSELRITAQENDMEVELPAAANSRKQFSVPPAPT
RPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSCLVKEVEK
MKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTM
TDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDL
TKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQT
GSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVT
FFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMID
MGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGA
DTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRD
SFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLI
QMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAME
ELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDV
IKALRLAMQLEEQASRQISSKKRPQ

Calculated Isoelectric Point:

8.03

Molecular Weight:

81313

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of KIF2C (rAg 11188) with molecular weight standards in lane 1
Click image to enlarge

CPTC-KIF2C PAGE

PAGE of KIF2C (rAg 11188) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com