KIAA1967


Background

Catalog Number:

CPTC-KIAA1967-1

Target Antigen:

KIAA1967

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

07/23/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-KIAA1967-1 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-KIAA1967-1 Western blot

Western Blot using CPTC-KIAA1967-1 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KIAA1967-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-KIAA1967-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-KIAA1967-1 NCI 60 Protein Array

Protein Array in which CPTC-KIAA1967-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Background

Catalog Number:

CPTC-KIAA1967-2

Target Antigen:

KIAA1967

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

07/23/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-KIAA1967-2 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-KIAA1967-2 Western blot

Western Blot using CPTC-KIAA1967-2 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KIAA1967-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-KIAA1967-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00056

Antigen Name:

KIAA1967

CPTC Name:

CPTC-KIAA1967

Keywords:

DBC1; DBC-1; NET35; P30 DBC; DBIRD Complex Subunit KIAA1967; Deleted In Breast Cancer 1; P30 DBC Protein; P30DBC; DBC.1; Deleted In Breast Cancer Gene 1 Protein

Function:

Core component of the DBIRD complex, a multiprotein complex that acts at the interface between core mRNP particles and RNA polymerase II (RNAPII) and integrates transcript elongation with the regulation of alternative splicing: the DBIRD complex affects local transcript elongation rates and alternative splicing of a large set of exons embedded in (A + T)-rich DNA regions. Inhibits SIRT1 deacetylase activity leading to increasing levels of p53/TP53 acetylation and p53-mediated apoptosis. Inhibits SUV39H1 methyltransferase activity

Chromosomal Localization:

8p22

Expression System:

E. coli

NCBI Accession Number:

NP_066997.3

Swiss Prot Accession Number:

Q8N163

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS pH 7.4

Expressed Sequence:

MHHHHHHSSGRENLYFQGKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYT
VDSPICDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQ
VSSEKEAAPDAGAEPITADSDPAYSSKVLLLSSPGLEELYRCCMLFVDDM
AEPRETPEHPLKQIKFLLGRKEEEAVLVGGEWSPSLDGLDPQADPQVLVR
TAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQTVVVYLPDVWTI
MPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDALEQAADTSRRNA
ETPEATTQQETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVEDRRPKER
ISFEVMVLAELFLEMLQRDFGYRVYKMLLSLPEKVVSPPEPEKEEAAKEE
ATKEEEAIKEEVVKEPKDEAQNEGPATES

Native Sequence:

Calculated Isoelectric Point:

4.7

Molecular Weight:

48265

Last Updated:

10/24/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-KIAA1967 PAGE

PAGE of KIAA1967 (rAg 00056) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com