KIAA1967


Background

Catalog Number:

CPTC-KIAA1967-1

Target Antigen:

KIAA1967

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KIAA1967-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-KIAA1967-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-KIAA1967-1 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-KIAA1967-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-KIAA1967-1 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-KIAA1967-1 Western blot

Result: Positive

Western Blot using CPTC-KIAA1967-1 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-KIAA1967-2

Target Antigen:

KIAA1967

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-KIAA1967-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-KIAA1967-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-KIAA1967-2 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-KIAA1967-2 Western blot

Result: Positive

Western Blot using CPTC-KIAA1967-2 as primary Ab against KIAA1967 (rAg 00056) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

00056

Antigen Name:

KIAA1967

CPTC Name:

CPTC-KIAA1967

Keywords:

DBC1; DBC-1; NET35; P30 DBC; DBIRD Complex Subunit KIAA1967; Deleted In Breast Cancer 1; P30 DBC Protein; P30DBC; DBC.1; Deleted In Breast Cancer Gene 1 Protein

Function:

Core component of the DBIRD complex, a multiprotein complex that acts at the interface between core mRNP particles and RNA polymerase II (RNAPII) and integrates transcript elongation with the regulation of alternative splicing: the DBIRD complex affects local transcript elongation rates and alternative splicing of a large set of exons embedded in (A + T)-rich DNA regions. Inhibits SIRT1 deacetylase activity leading to increasing levels of p53/TP53 acetylation and p53-mediated apoptosis. Inhibits SUV39H1 methyltransferase activity

Chromosomal Localization:

8p22

Expression System:

E. coli

NCBI Accession Number:

NP_066997.3

Swiss Prot Accession Number:

Q8N163

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET28-MHL

Extinction Coefficient:

Buffers:

PBS pH 7.4

Expressed Sequence:

MHHHHHHSSGRENLYFQGKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYT
VDSPICDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQ
VSSEKEAAPDAGAEPITADSDPAYSSKVLLLSSPGLEELYRCCMLFVDDM
AEPRETPEHPLKQIKFLLGRKEEEAVLVGGEWSPSLDGLDPQADPQVLVR
TAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQTVVVYLPDVWTI
MPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDALEQAADTSRRNA
ETPEATTQQETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVEDRRPKER
ISFEVMVLAELFLEMLQRDFGYRVYKMLLSLPEKVVSPPEPEKEEAAKEE
ATKEEEAIKEEVVKEPKDEAQNEGPATES

Native Sequence:

Calculated Isoelectric Point:

4.7

Molecular Weight:

48265

Last Updated:

11/14/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of KIAA1967 (rAg 00056) with molecular weight standards in lane 1
Click image to enlarge

CPTC-KIAA1967 PAGE

PAGE of KIAA1967 (rAg 00056) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com