Interleukin 6


Background

Catalog Number:

CPTC-IL6-1

Target Antigen:

Interleukin 6

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-IL6-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-IL6-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-IL6-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-IL6-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-IL6-1 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL6-1 Western blot

Result: Positive

Western Blot using CPTC-IL6-1 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-IL6-2

Target Antigen:

Interleukin 6

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-IL6-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-IL6-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-IL6-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-IL6-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-IL6-2 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL6-2 Western blot

Result: Positive

Western Blot using CPTC-IL6-2 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-IL6-3

Target Antigen:

Interleukin 6

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-IL6-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-IL6-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-IL6-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-IL6-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-IL6-3 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL6-3 Western blot

Result: Positive

Western Blot using CPTC-IL6-3 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10142

Antigen Name:

Interleukin 6

CPTC Name:

CPTC-IL6

Keywords:

interleukin 6; IL-6; BSF2; HGF; IFNB2; Hybridoma growth factor; Interferon beta-2; BSF-2; CDF; IFN-beta-2; B-cell stimulatory factor 2; CTL differentiation factor; OTTHUMP00000158544; OTTHUMP00000198486; OTTHUMP00000198490; B cell stimulatory factor-2; B-cell differentiation factor; interleukin BSF-2; interleukin-6

Function:

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile
rheumatoid arthritis.

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response.
Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance

Chromosomal Localization:

7p21-p15

Expression System:

E. Coli

NCBI Accession Number:

BC015511

Swiss Prot Accession Number:

P05231

DNA Source:

DNASU - HsCD00002062

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

10095

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKS
NMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVY
LEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASL
LTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Native Sequence:

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSS
ERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDG
CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL
IQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKE
FLQSSLRALRQM

Calculated Isoelectric Point:

6.17

Molecular Weight:

21182

Last Updated:

11/14/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of IL6 (rAg 10142) with molecular weight standards in lane 1
Click image to enlarge

CPTC-IL6 SDS PAGE

PAGE of IL6 (rAg 10142) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com