Interleukin 6


Background

Catalog Number:

CPTC-IL6-1

Target Antigen:

Interleukin 6

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/12/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-IL6-1 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL6-1 Western blot

Western Blot using CPTC-IL6-1 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-IL6-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-IL6-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-IL6-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-IL6-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-IL6-2

Target Antigen:

Interleukin 6

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

04/29/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-IL6-2 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL6-2 Western blot

Western Blot using CPTC-IL6-2 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-IL6-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-IL6-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-IL6-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-IL6-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-IL6-3

Target Antigen:

Interleukin 6

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-IL6-3 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-IL6-3 Western blot

Western Blot using CPTC-IL6-3 as primary Ab against IL6 (rAg 10142) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-IL6-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-IL6-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-IL6-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-IL6-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10142

Antigen Name:

Interleukin 6

CPTC Name:

CPTC-IL6

Keywords:

interleukin 6; IL-6; BSF2; HGF; IFNB2; Hybridoma growth factor; Interferon beta-2; BSF-2; CDF; IFN-beta-2; B-cell stimulatory factor 2; CTL differentiation factor; OTTHUMP00000158544; OTTHUMP00000198486; OTTHUMP00000198490; B cell stimulatory factor-2; B-cell differentiation factor; interleukin BSF-2; interleukin-6

Function:

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile
rheumatoid arthritis.

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response.
Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance

Chromosomal Localization:

7p21-p15

Expression System:

E. Coli

NCBI Accession Number:

BC015511

Swiss Prot Accession Number:

P05231

DNA Source:

DNASU - HsCD00002062

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

10095

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDG
ISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGC
FQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQ
ARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLT
KLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Native Sequence:

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPH
RQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALA
ENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYL
QNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTN
ASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Calculated Isoelectric Point:

6.17

Molecular Weight:

21182

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-IL6 SDS PAGE

PAGE of IL6 (rAg 10142) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com