Heat shock 27kDa protein 1


Background

Catalog Number:

CPTC-HSPB1-1

Target Antigen:

Heat shock 27kDa protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (96.6 KB)

CPTC-HSPB1-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-HSPB1-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-HSPB1-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (i.e., binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-HSPB1-1 Indirect ELISA

Result: Positive

Indirect ELISA (i.e., binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-HSPB1-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-HSPB1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4). Click image to enlarge

CPTC-HSPB1-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-HSPB1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-HSPB1-1 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click image to enlarge

CPTC-HSPB1-1 Western blot

Result: Positive

Western Blot using CPTC-HSPB1-1 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-HSPB1-2

Target Antigen:

Heat shock 27kDa protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (107.6 KB)

CPTC-HSPB1-2

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-HSPB1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-HSPB1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-HSPB1-2 Protein Array

Result: Positive

Protein Array in which CPTC-HSPB1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-HSPB1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4). Click image to enlarge

CPTC-HSPB1-2 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-HSPB1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-HSPB1-2 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-HSPB1-2 Western blot

Result: Positive

Western Blot using CPTC-HSPB1-2 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-HSPB1-3

Target Antigen:

Heat shock 27kDa protein 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length, Native Protein

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (92.8 KB)

CPTC-HSPB1-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-HSPB1-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-HSPB1-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-HSPB1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105. Click image to enlarge

CPTC-HSPB1-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-HSPB1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4). Click image to enlarge

CPTC-HSPB1-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-HSPB1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-HSPB1-3 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-HSPB1-3 Western blot

Result: Positive

Western Blot using CPTC-HSPB1-3 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

Background

NCI Identification Number:

10175

Antigen Name:

Heat shock 27kDa protein 1

CPTC Name:

CPTC-HSPB1

Keywords:

HSPB1; CMT2F; HMN2B; DKFZp586P1322; HS.76067; HSP27; HSP28; Hsp25; HspB1; OTTHUMP00000024846; SRP27

Function:

Involved in stress resistance and actin organization

Chromosomal Localization:

7q11.23

Expression System:

E. Coli

NCBI Accession Number:

NM_001540

Swiss Prot Accession Number:

P04792

DNA Source:

HIP:HsCD00000450

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

40450

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLG
GSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRV
SLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPG
VDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAA
KSDETAAK

Native Sequence:

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSS
WPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD
VNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDP
TQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSD
ETAAK

Calculated Isoelectric Point:

5.97

Molecular Weight:

23055

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10175 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10175

PAGE of Ag 10175 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com