PRINT

Heat Shock 27kDa Protein 1

Antibody: CPTC-HSPB1-1
Background

Catalog Number:

CPTC-HSPB1-1

RRID:

AB_2617267

Target Antigen:

Heat Shock 27kDa Protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (96.6 KB)

CPTC-HSPB1-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60

CPTC-HSPB1-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-HSPB1-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:150 Human assay: U-2 OS fixed with PFA, dilution: 1:150 Human assay: U-251 MG fixed with PFA, dilution: 1:150 Click image to enlarge

CPTC-HSPB1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Human assay: A-431 fixed with PFA, dilution: 1:150
Human assay: U-2 OS fixed with PFA, dilution: 1:150
Human assay: U-251 MG fixed with PFA, dilution: 1:150


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (i.e., binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-HSPB1-1 Indirect ELISA

Result: Positive

Indirect ELISA (i.e., binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-HSPB1-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-HSPB1-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:500


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-HSPB1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4). Click image to enlarge

CPTC-HSPB1-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-HSPB1-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-HSPB1-1 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-HSPB1-1 Western blot

Result: Positive

Western Blot using CPTC-HSPB1-1 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-HSPB1-2
Background

Catalog Number:

CPTC-HSPB1-2

RRID:

AB_2617268

Target Antigen:

Heat Shock 27kDa Protein 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (107.6 KB)

CPTC-HSPB1-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:2000 Human assay: U-2 OS fixed with PFA, dilution: 1:2000 Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-HSPB1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-HSPB1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-HSPB1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-HSPB1-2 Protein Array

Result: Positive

Protein Array in which CPTC-HSPB1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500 Click image to enlarge

CPTC-HSPB1-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-HSPB1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4). Click image to enlarge

CPTC-HSPB1-2 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-HSPB1-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-HSPB1-2 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-HSPB1-2 Western blot

Result: Positive

Western Blot using CPTC-HSPB1-2 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

[top]

Antibody: CPTC-HSPB1-3
Background

Catalog Number:

CPTC-HSPB1-3

RRID:

AB_2617269

Target Antigen:

Heat Shock 27kDa Protein 1

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

03/09/2023

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (92.8 KB)

CPTC-HSPB1-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


Characterization SOP Files

  IHC NCI60

CPTC-HSPB1-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  IHC Tissue

CPTC-HSPB1-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


Characterization SOP Files

  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:75 Human assay: U-2 OS fixed with PFA, dilution: 1:75 Human assay: U-251 MG fixed with PFA, dilution: 1:75 Click image to enlarge

CPTC-HSPB1-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:75
Human assay: U-2 OS fixed with PFA, dilution: 1:75
Human assay: U-251 MG fixed with PFA, dilution: 1:75


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-HSPB1-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105. Click image to enlarge

CPTC-HSPB1-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500. Click image to enlarge

CPTC-HSPB1-3 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data. Analysis performed using a standard panel of samples. Antibody dilution: 1:500.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-HSPB1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4). Click image to enlarge

CPTC-HSPB1-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-HSPB1-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag HSPB1 (NCI 10175) in (lane 4).


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-HSPB1-3 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-HSPB1-3 Western blot

Result: Positive

Western Blot using CPTC-HSPB1-3 as primary Ab against rAg 10175 (HSPB1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Characterization SOP Files

[top]

Antigen: Heat Shock 27kDa Protein 1
Background

NCI Identification Number:

10175

Antigen Name:

Heat Shock 27kDa Protein 1

CPTC Name:

CPTC-HSPB1

Aliases:

HSPB1; CMT2F; HMN2B; DKFZp586P1322; HS.76067; HSP27; HSP28; Hsp25; HspB1; OTTHUMP00000024846; SRP27

Function:

Involved in stress resistance and actin organization

Chromosomal Localization:

7q11.23

Expression System:

E. Coli

Accession Number:

NM_001540

UniProt Accession Number:

P04792

DNA Source:

HIP:HsCD00000450

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

40450

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLG
GSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRV
SLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPG
VDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAA
KSDETAAK

Native Sequence:

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSS
WPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD
VNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDP
TQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSD
ETAAK

Calculated Isoelectric Point:

5.97

Molecular Weight:

23055

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10175 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10175

PAGE of Ag 10175 (with molecular weight standards in lane 1)

[top]

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]