HPV 18 L1 VLP


Background

Catalog Number:

CPTC-HPV 18 L1 VLP-1

Target Antigen:

HPV 18 L1 VLP

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

08/17/2018

Antigen Recognition(s):

Recombinant Full-length

SOP:

Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-HPV18 VLP-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Background

Catalog Number:

CPTC-HPV 18 L1 VLP-2

Target Antigen:

HPV 18 L1 VLP

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

08/17/2018

Antigen Recognition(s):

Recombinant Full-length

SOP:

Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-HPV18 VLP-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

Background

Catalog Number:

CPTC-HPV 18 L1 VLP-3

Target Antigen:

HPV 18 L1 VLP

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

08/17/2018

Antigen Recognition(s):

Recombinant Full-length

SOP:

Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-HPV18 VLP-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

Background

NCI Identification Number:

00260

Antigen Name:

HPV 18 L1 VLP

CPTC Name:

CPTC-HPV 18 L1 VLP

Keywords:

Function:

Virus like particles (VLPs) based on the L1 major capsid protein from HPV. Pooled human serum is used and serves as the current standard for some of the serological assays, which is used to create a curve from which results are extrapolated in arbitrary Units/ml.

VLPs are noninfectious protein capsids which can be produced by expressing the capsid protein in mammailian, yeast or insect cells. The recombinant L1 capsid protein assembles in into the 60-nm HPV VLP.

Reference for HPV-16 L1 plasmid and protein origins: Enhancement of Capsid Gene Expression: Leder, C. el al. "Preparing the Human Papillomavirus Type 16 Major Structural Gene L1 for DNA Vaccination Purposes" J. Virology (2001) 75:9201-9209.

Chromosomal Localization:

Expression System:

Mammalian

NCBI Accession Number:

000

UniProt Accession Number:

DNA Source:

N/A

Immunogen:

Native Protein

Vector Name:

N/A

Extinction Coefficient:

Buffers:

Expressed Sequence:

MALWRPSDNTVYLPPPSVARVVNTDDYVTRTSIFYHAGSSRLLTVGNPYF
RVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVW
ACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVD
YKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDM
VDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCL
RREQLFARHFWNRAGTMGDTVPQSLYIKGTGMRASPGSCVYSPSPSGSIV
TSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTRSTNLTICASTQS
PVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSIL
EDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNV
DLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPAKR
VRVRARK

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

1

Last Updated:

05/17/2018

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com