Homeobox D12 Peptide 1


Background

Catalog Number:

CPTC-HOXD12-1

Target Antigen:

Homeobox D12 Peptide 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/24/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-HOXD12-1 antibody and BSA-conjugated peptide, RTRPSFAPESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPL, were measured using surface plasmon resonance. BSA-conjugated peptide was amine coupled onto a Series S CM5 biosensor chip.  CPTC-HOXD12-1 antibody was used as analyte and was titrated at 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM. All binding data were double referenced and analyzed globally using a 1:1 fitting model. Click image to enlarge

CPTC-HOXD12-1 Affinity and Kinetics (Surface Plasmon Resonance)

Result: Medium Low Binding

Affinity and binding kinetics of CPTC-HOXD12-1 antibody and BSA-conjugated peptide, RTRPSFAPESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPL, were measured using surface plasmon resonance. BSA-conjugated peptide was amine coupled onto a Series S CM5 biosensor chip. CPTC-HOXD12-1 antibody was used as analyte and was titrated at 1024 nM, 256 nM, 64 nM, 16 nM, and 4 nM. All binding data were double referenced and analyzed globally using a 1:1 fitting model.


  Flow Cytometry

CPTC-HOXD12-1 Flow Cytometry

Result: Negative

Flow cytometric analysis of Homeobox protein Hox-D12 expression using CPTC-HOXD12-1 mouse antibody. CCRF-CEM cells were fixed, permeabilized, and then stained with CPTC-HOXD12-1 or concentration-matched mouse isotype control antibodies. HL-60 cells were fixed, permeabilized, and then stained with CPTC-HOXD12-1 or concentration-matched mouse isotype control antibodies. A BV421 conjugated goat anti-mouse IgG was used as a secondary antibody. All data were analyzed using FlowJo.


  Indirect ELISA
Click to enlarge image Indirect ELISA using CPTC-HOXD12-1 as primary mouse antibody against HODX12 BSA peptide1, coated on the plate and detected using the goat anti mouse antibody and TMB. Click image to enlarge

CPTC-HOXD12-1 Indirect ELISA

Result: High Binding

Indirect ELISA using CPTC-HOXD12-1 as primary mouse antibody against HODX12 BSA peptide1, coated on the plate and detected using the goat anti mouse antibody and TMB.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-HOXD12-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using antibody CPTC-HOXD12-1 as primary antibody against the over-expressed lysate of HOXD12. The antibody recognizes the target protein. The same over-expressed lysate was probed with an anti-vinculin antibody and the housekeeping protein was detected. Click image to enlarge

CPTC-HOXD12-1 Western Blot (Over-expressed Lysate)

Result: Positive

Western Blot using antibody CPTC-HOXD12-1 as primary antibody against the over-expressed lysate of HOXD12. The antibody recognizes the target protein. The same over-expressed lysate was probed with an anti-vinculin antibody and the housekeeping protein was detected.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image Simple Western using antibody CPTC-HOXD12-1 as primary antibody to probe a selection of cancer cell lysates (MCF7, SB-75, H460, CAKI-1, MOLT-4, SF-295, SF-268, SF-539, SNB-19, U251). The target protein was detected in all tested lysates. the same cell lysates were probed with an anti-vinculin antibody and all the tested lysates showed expression of the housekeeping protein. The same overexpressed lysate was probed with an anti-vinculin antibody and the housekeeping protein was detected in all the tested lysates. Click image to enlarge

CPTC-HOXD12-1 Simple Western (Cancer Cell Lysates)

Result: Positive

Simple Western using antibody CPTC-HOXD12-1 as primary antibody to probe a selection of cancer cell lysates (MCF7, SB-75, H460, CAKI-1, MOLT-4, SF-295, SF-268, SF-539, SNB-19, U251). The target protein was detected in all tested lysates. the same cell lysates were probed with an anti-vinculin antibody and all the tested lysates showed expression of the housekeeping protein. The same overexpressed lysate was probed with an anti-vinculin antibody and the housekeeping protein was detected in all the tested lysates.


Background

NCI Identification Number:

00558

Antigen Name:

Homeobox D12 Peptide 1

CPTC Name:

CPTC-HOXD12 Peptide 1

Aliases:

Homeobox D12; HOX4H; Homeobox Protein Hox-D12; Homeobox Protein Hox-4H; Homeo Box D12; Hox-4.7, Mouse, Homolog Of

Function:

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined.HOXD12 (Homeobox D12) is a Protein Coding gene. Diseases associated with HOXD12 include Synpolydactyly and Brachydactyly-Syndactyly Syndrome. Gene Ontology (GO) annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is HOXC12.

Chromosomal Localization:

2q31.1

Accession Number:

UniProt Accession Number:

P35452

DNA Source:

N/A

Immunogen:

Synthetic Peptide

Vector Name:

N/A

Extinction Coefficient:

Buffers:

Expressed Sequence:

RTRPSFAPESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFK
DDTKGPL

Native Sequence:

Calculated Isoelectric Point:

Molecular Weight:

6270

Last Updated:

07/03/2024

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com