Gelsolin


Background

Catalog Number:

CPTC-Gelsolin-1

Target Antigen:

Gelsolin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Gelsolin-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Gelsolin-1 CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Gelsolin-1 Protein Array

Result: Positive

Protein Array in which CPTC-Gelsolin-1 CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Gelsolin-1 as primary Ab against Ag 10594 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-1 Western Blot

Result: Positive

Western Blot using CPTC-Gelsolin-1 as primary Ab against Ag 10594 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-Gelsolin-2

Target Antigen:

Gelsolin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This table summarizes the results of the pairing experiment with Gelsolin antibodies. (769.0 KB)

SPR pairing results

Result: Positive

This table summarizes the results of the pairing experiment with Gelsolin antibodies.


  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for Gelsolin-2 using Biacore SPR method Click image to enlarge

CPTC-Gelsolin-2 SPR

Result: Positive

Kinetic titration data for Gelsolin-2 using Biacore SPR method


  IHC NCI60

CPTC-Gelsolin-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-Gelsolin-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-Gelsolin-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-Gelsolin-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-Gelsolin-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2). Click image to enlarge

CPTC-Gelsolin-2 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-Gelsolin-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Gelsolin-2 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-2 Western blot

Result: Positive

Western Blot using CPTC-Gelsolin-2 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-Gelsolin-3

Target Antigen:

Gelsolin

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This table summarizes the results of the pairing experiment with Gelsolin antibodies. (769.0 KB)

SPR pairing results

Result: Positive

This table summarizes the results of the pairing experiment with Gelsolin antibodies.


  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for Gelsolin-3 antibody using Biacore SPR method Click image to enlarge

CPTC-Gelsolin-3 SPR

Result: Positive

Kinetic titration data for Gelsolin-3 antibody using Biacore SPR method


  IHC NCI60

CPTC-Gelsolin-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC NCI60

CPTC-Gelsolin-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-Gelsolin-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-Gelsolin-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-Gelsolin-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2). Click image to enlarge

CPTC-Gelsolin-3 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-Gelsolin-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Gelsolin-3 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-3 Western blot

Result: Positive

Western Blot using CPTC-Gelsolin-3 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-Gelsolin-4

Target Antigen:

Gelsolin

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This table summarizes the results of the pairing experiment with Gelsolin antibodies. (769.0 KB)

SPR pairing results

Result: Positive

This table summarizes the results of the pairing experiment with Gelsolin antibodies.


  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method Click image to enlarge

CPTC Gelsolin-4 SPR

Result: Positive

Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method


  IHC NCI60

CPTC-Gelsolin-4 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-Gelsolin-4 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-Gelsolin-4 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-Gelsolin-4 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western Blot using CPTC-Gelsolin-4 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2). Click image to enlarge

CPTC-Gelsolin-4 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-Gelsolin-4 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Gelsolin-4 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-4 Western blot

Result: Positive

Western Blot using CPTC-Gelsolin-4 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10594

Antigen Name:

Gelsolin

CPTC Name:

CPTC-Gelsolin

Keywords:

amyloidosis, Finnish type; GSN; ADF; AGEL; Brevin; DKFZp313L0718; OTTHUMP00000022011; OTTHUMP00000162202

Function:

The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments
to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.

Chromosomal Localization:

9q33

Expression System:

E. Coli

NCBI Accession Number:

BC026033

Swiss Prot Accession Number:

P06396

DNA Source:

HIP:HsCD00005767

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

115405

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVE
KFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDE
SGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVAS
GFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNI
HQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVL
GPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQG
ALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQ
TQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDA
ATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSY
IILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQS
RVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAG
ATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRV
LRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSN
KIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEAL
TSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLD
RAMAELAA

Native Sequence:

MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPN
SMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKT
VQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQ
GFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRA
TEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDN
ERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQA
NTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPD
QTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIW
RIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ
DEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGG
TSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAA
YRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVML
LDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQG
FEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Calculated Isoelectric Point:

5.71

Molecular Weight:

83231

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10594 with molecular weight standards in lane 1
Click image to enlarge

Ag 10594 PAGE

PAGE of Ag 10594 with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com