Glutathione S-Transferase Mu2


Background

Catalog Number:

CPTC-GSTMu2-1

Target Antigen:

Glutathione S-Transferase Mu2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Click to enlarge image Kinetic titration data for GSTMu2-1 Ab (623A2.1) using Biacore SPR method Click image to enlarge

CPTC-GSTMu2-1 SPR

Result: Positive

Kinetic titration data for GSTMu2-1 Ab (623A2.1) using Biacore SPR method


  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.  Click image to enlarge

Cross Reactivity Data

Result: Positive

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GSTMu2-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GSTMu2-1 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GSTMu2-1 Western Blot

Result: Negative

Western Blot using CPTC-GSTMu2-1 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GSTMu2-2

Target Antigen:

Glutathione S-Transferase Mu2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.  Click image to enlarge

Cross Reactivity Data

Result: Positive

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GSTMu2-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GSTMu2-2 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GSTMu2-2 Western Blot

Result: Positive

Western Blot using CPTC-GSTMu2-2 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GSTMu2-3

Target Antigen:

Glutathione S-Transferase Mu2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Cross Reactivity Data
Click to enlarge image This table shows the cross reactivity by indirect ELISA with the GST group of antigens.  Click image to enlarge

Cross Reactivity Data

Result: Positive

This table shows the cross reactivity by indirect ELISA with the GST group of antigens.


Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-GSTMu2-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GSTMu2-3 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GSTMu2-3 Western Blot

Result: Positive

Western Blot using CPTC-GSTMu2-3 as primary Ab against Ag 10112 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10112

Antigen Name:

Glutathione S-Transferase Mu2

CPTC Name:

CPTC-GSTMu2

Keywords:

GSTM2; EC 2.5.1.18; GST4; GSTM; GSTM2-2; GTHMUS; MGC117303; OTTHUMP00000013351

Function:

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles

Chromosomal Localization:

1p13.3

Expression System:

E. Coli

NCBI Accession Number:

NM_000848

Swiss Prot Accession Number:

P28161

DNA Source:

HIP:HsCD00000624

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

39943

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWL
NEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIRE
DILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPW
FLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAY
MKSSRFLPRPVFTKMAVWGNK

Native Sequence:

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEK
FKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDIL
ENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLG
DKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKS
SRFLPRPVFTKMAVWGNK

Calculated Isoelectric Point:

5.99

Molecular Weight:

26017

Last Updated:

11/25/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10112 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-GSTMu2

PAGE of Ag 10112 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com