Glucose phosphate isomerase


Background

Catalog Number:

CPTC-GPI-1

Target Antigen:

Glucose phosphate isomerase

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

recombinant full-length

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GPI-1 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GPI-1 Western Blot

Western Blot using CPTC-GPI-1 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-GPI-1 Click image to enlarge

CPTC-GPI-1 Indirect ELISA

Indirect ELISA of CPTC-GPI-1

Characterization SOP Files

Background

Catalog Number:

CPTC-GPI-2

Target Antigen:

Glucose phosphate isomerase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GPI-2 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GPI-2 Western Blot

Western Blot using CPTC-GPI-2 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-GPI-2 Click image to enlarge

CPTC-GPI-2 Indirect ELISA

Indirect ELISA of CPTC-GPI-2

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GPI-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GPI-2 NCI 60 Protein Array

Protein Array in which CPTC-GPI-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60

CPTC-GPI-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-GPI-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  NAPPA
Download GPI-2 pos.pdf (1.0 MB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Background

Catalog Number:

CPTC-GPI-3

Target Antigen:

Glucose phosphate isomerase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GPI-3 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click image to enlarge

CPTC-GPI-3 Western Blot

Western Blot using CPTC-GPI-3 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-GPI-3 Click image to enlarge

CPTC-GPI-3 Indirect ELISA

Indirect ELISA of CPTC-GPI-3

Characterization SOP Files

  NCI 60 Protein Array

CPTC-GPI-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-GPI-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-GPI-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  NAPPA
Download GPI-3 pos.pdf (979.4 KB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Background

NCI Identification Number:

10078

Antigen Name:

Glucose phosphate isomerase

CPTC Name:

CPTC-GPI

Keywords:

GPI; AMF; GNPI; NLK; Neuroleukin; PGI; PHI; SA-36; oxoisomerase; phosphohexomutase; phosphosaccharomutase; EC 5.3.1.9

Function:

This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Neuroleukin is a neurotrophic factor for spinal and sensory neurons.

Chromosomal Localization:

19q13.1

Expression System:

E. Coli

NCBI Accession Number:

BC004982

Swiss Prot Accession Number:

P06744

DNA Source:

HIP : HsCD00003344

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

86985

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVN
KVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSN
IDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTN
TTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPL
EKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQT
GPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMR
GKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQ
GIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ

Native Sequence:

MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTE
DVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNK
VLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSN
IDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALST
NTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTT
PLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVD
HQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTE
ALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEH
KIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ

Calculated Isoelectric Point:

8.42

Molecular Weight:

63419

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA of CPTC-GPI-3
Click image to enlarge

CPTC-GPI PAGE

PAGE of Ag 10078 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com