Glucose Phosphate Isomerase


Background

Catalog Number:

CPTC-GPI-1

RRID:

AB_10573806

Target Antigen:

Glucose Phosphate Isomerase

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (170.3 KB)

CPTC-GPI-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400 Click image to enlarge

CPTC-GPI-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:400
Human assay: U-2 OS fixed with PFA, dilution: 1:400
Human assay: U-251 MG fixed with PFA, dilution: 1:400


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-GPI-1 Click image to enlarge

CPTC-GPI-1 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-GPI-1


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250. Click image to enlarge

CPTC-GPI-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Band of predicted size in kDa (+/-20%) with additional bands present. Analysis performed using a standard panel of samples. Antibody dilution: 1:250.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GPI-1 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GPI-1 Western Blot

Result: Positive

Western Blot using CPTC-GPI-1 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GPI-2

RRID:

AB_10571450

Target Antigen:

Glucose Phosphate Isomerase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (111.7 KB)

CPTC-GPI-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-GPI-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-GPI-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-GPI-2 Click image to enlarge

CPTC-GPI-2 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-GPI-2


Characterization SOP Files

  NAPPA
Download This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique. (1.0 MB)

Evaluation of antibody by NAPPA

Result: Positive

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-GPI-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-GPI-2 NCI 60 Protein Array

Result: Positive

Protein Array in which CPTC-GPI-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GPI-2 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GPI-2 Western Blot

Result: Positive

Western Blot using CPTC-GPI-2 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-GPI-3

RRID:

AB_2112658

Target Antigen:

Glucose Phosphate Isomerase

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (120.3 KB)

CPTC-GPI-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-GPI-3 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-GPI-3 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA of CPTC-GPI-3 Click image to enlarge

CPTC-GPI-3 Indirect ELISA

Result: Positive

Indirect ELISA of CPTC-GPI-3


Characterization SOP Files

  NAPPA
Download This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique. (979.4 KB)

Evaluation of antibody by NAPPA

Result: Positive

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.


  NCI 60 Protein Array

CPTC-GPI-3 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-GPI-3 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click image to enlarge

CPTC-GPI-3 Western Blot

Result: Positive

Western Blot using CPTC-GPI-3 as primary Ab against Ag 10078 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10078

Antigen Name:

Glucose Phosphate Isomerase

CPTC Name:

CPTC-GPI

Keywords:

GPI; AMF; GNPI; NLK; Neuroleukin; PGI; PHI; SA-36; oxoisomerase; phosphohexomutase; phosphosaccharomutase; EC 5.3.1.9

Function:

This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Neuroleukin is a neurotrophic factor for spinal and sensory neurons.

Chromosomal Localization:

19q13.1

Expression System:

E. Coli

NCBI Accession Number:

BC004982

UniProt Accession Number:

P06744

DNA Source:

HIP : HsCD00003344

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

86985

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTN
HGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRA
VLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGK
TITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLA
QLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALS
TNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLL
SGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHR
FAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQ
GTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARK
ELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHK
IFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLIN
FIKQQREARVQ

Native Sequence:

MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGH
ILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLH
VALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTIT
DVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLN
PESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNT
TKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAA
YFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQ
AAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFV
QGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIK
QQREARVQ

Calculated Isoelectric Point:

8.42

Molecular Weight:

63419

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10078 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-GPI PAGE

PAGE of Ag 10078 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com