GI.1 Norovirus RNA dependent RNA polymerase


Background

Catalog Number:

CPTC-GI.1 Norovirus RDRP-1

Target Antigen:

GI.1 Norovirus RNA dependent RNA polymerase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

06/02/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GI.1 Norovirus RDRP-1 as primary Ab against (rAg 00091) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GI.1 Norovirus RDRP-1 Western blot

Western Blot using CPTC-GI.1 Norovirus RDRP-1 as primary Ab against (rAg 00091) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-GI.1 Norovirus RDRP-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Background

Catalog Number:

CPTC-GI.1 Norovirus RDRP-2

Target Antigen:

GI.1 Norovirus RNA dependent RNA polymerase

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

06/02/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GI.1 Norovirus RDRP-2 as primary Ab against rAg 00091 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GI.1 Norovirus RDRP-2 Western blot

Western Blot using CPTC-GI.1 Norovirus RDRP-2 as primary Ab against rAg 00091 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-GI.1 Norovirus RDRP-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Background

Catalog Number:

CPTC-GI.1 Norovirus RDRP-3

Target Antigen:

GI.1 Norovirus RNA dependent RNA polymerase

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

06/02/2015

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-GI.1 Norovirus RDRP-3 as primary Ab against rAg 00091 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-GI.1 Norovirus RDRP-3 Western blot

Western Blot using CPTC-GI.1 Norovirus RDRP-3 as primary Ab against rAg 00091 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-GI.1 Norovirus RDRP-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Background

NCI Identification Number:

00091

Antigen Name:

GI.1 Norovirus RNA dependent RNA polymerase

CPTC Name:

CPTC-GI.1 Norovirus RDRP

Keywords:

NS7; RDP; RDRP; NS7 G1

Function:

The monoclonal antibodies are directed against the norovirus GI.1 RNA-dependent RNA polymerase (RdRP) protein, also called Pol or NS7. The norovirus RdRP is an enzyme responsible for replication of the viral RNA genome. Detection of the RdRP in infected cells or tissues is indicative of active norovirus replication.

Chromosomal Localization:

Expression System:

E.coli

NCBI Accession Number:

M87661

Swiss Prot Accession Number:

DNA Source:

N/A

Immunogen:

Recombinant Full Length Protein

Vector Name:

pET

Extinction Coefficient:

Buffers:

Expressed Sequence:

GGDKGHYAGHEIVRYGSGPALSTKTKFWRSSPEPLPPGVYEPAYLGGKDP
RVQNGPSLQQVLRDQLKPFADPRGRMPEPGLLEAAVETVTSMLEQTMDTP
SPWSYADACQSLDKTTSSGYPHHKRKNDDWNGTTFVGELGEQAAHANNMY
ENAKHMKPIYTAALKDELVKPEKIYQKVKKRLLWGADLGTVVRAARAFGP
FCDAIKSHVIKLPIKVGMNTIEDGPLIYAEHAKYKNHFDADYTAWDSTQN
RQIMTESFSIMSRLTASPELAEVVAQDLLAPSEMDVGDYVIRVKEGLPSG
FPCTSQVNSINHWIITLCALSEATGLSPDVVQSMSYFSFYGDDEIVSTDI
DFDPARLTQILKEYGLKPTRPDKTEGPIQVRKNVDGLVFLRRTISRDAAG
FQGRLDRASIERQIFWTRGPNHSDPSETLVPHTQRKIQLISLLGEASLHG
EKFYRKISSKVIHEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRDLLP
EFVNDDGV

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

58000

Last Updated:

04/28/2015

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com