Fatty Acid-Binding Protein, Epidermal


Background

Catalog Number:

CPTC-FABP5-1

RRID:

AB_10659718

Target Antigen:

Fatty Acid-Binding Protein, Epidermal

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/21/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This is a summary of antibody pairing studies by SPR. (793.1 KB)

CPTC-FABP5-1 Affinity and Kinetics (Surface Plasmon Resonance)

Result: High Binding

This is a summary of antibody pairing studies by SPR.


  CyTOF
Click to enlarge image Imaging mass cytometry on colon cancer tissue core using CPTC-FABP5-1 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate). Click image to enlarge

CPTC-FABP5-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on colon cancer tissue core using CPTC-FABP5-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (112.6 KB)

CPTC-FABP5-1 IHC evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP5-1 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-FABP5-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FABP5-1 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FABP5-1 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-FABP5-1 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-FABP5-2

RRID:

AB_10660292

Target Antigen:

Fatty Acid-Binding Protein, Epidermal

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/21/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This summarizes antibody pairing studies by SPR. (793.1 KB)

CPTC-FABP5-2 Affinity and Kinetics (Surface Plasmon Resonance)

Result: High Binding

This summarizes antibody pairing studies by SPR.


  CyTOF
Click to enlarge image Imaging mass cytometry on normal liver tissue core using CPTC-FABP5-2 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate). Click image to enlarge

CPTC-FABP5-2 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on normal liver tissue core using CPTC-FABP5-2 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (118.5 KB)

CPTC-FABP5-2 IHC evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP5-2 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-FABP5-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FABP5-2 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FABP5-2 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-FABP5-2 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Characterization SOP Files

Background

Catalog Number:

CPTC-FABP5-3

RRID:

AB_10660832

Target Antigen:

Fatty Acid-Binding Protein, Epidermal

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/21/2025

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Affinity Measurement by SPR
Download This summarizes antibody pairing studies by SPR. (793.1 KB)

CPTC-FABP5-3 Affinity and Kinetics (Surface Plasmon Resonance)

Result: High Binding

This summarizes antibody pairing studies by SPR.


  CyTOF
Click to enlarge image Imaging mass cytometry on normal kidney tissue core using CPTC-FABP5-3 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate). Click image to enlarge

CPTC-FABP5-3 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on normal kidney tissue core using CPTC-FABP5-3 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (liver, bone marrow, spleen, placenta, prostate, colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (colon, breast, ovarian, lung, and prostate).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (134.4 KB)

CPTC-FABP5-3 IHC evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:10
Human assay: U-2 OS fixed with PFA, dilution: 1:10 Click image to enlarge

CPTC-FABP5-3 IF evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Human assay: A-431 fixed with PFA, dilution: 1:10
Human assay: U-2 OS fixed with PFA, dilution: 1:10


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP5-3 Indirect ELISA

Result: High Binding

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  Western Blot - HPA - tissue or cell lysate
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org).  Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:250. Click image to enlarge

CPTC-FABP5-3 Western Blot (Cell Lysate) evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). Single band corresponding to the predicted size in kDa (+/-20%). Analysis performed using a standard panel of samples. Antibody dilution: 1:250.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FABP5-3 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FABP5-3 Western Blot (Recombinant Protein)

Result: Positive

Western Blot using CPTC-FABP5-3 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10280

Antigen Name:

Fatty Acid-Binding Protein, Epidermal

CPTC Name:

CPTC-FABP5

Aliases:

FABP5; E-FABP; EFABP; PA-FABP; PAFABP

Function:

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.

Chromosomal Localization:

8q21.13

Expression System:

E. Coli

Accession Number:

BC019385

UniProt Accession Number:

Q01469

DNA Source:

HIP : HsCD00002133

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

14168

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITC
DGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQH
QEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Native Sequence:

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGK
NLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEW
DGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Calculated Isoelectric Point:

6.57

Molecular Weight:

15437

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10280 with molecular weight standards in lane 1
Click image to enlarge

Ag 10280

PAGE of Ag 10280 with molecular weight standards in lane 1

Characterization SOP Files

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com