Fatty acid-binding protein, epidermal


Background

Catalog Number:

CPTC-FABP5-1

Target Antigen:

Fatty acid-binding protein, epidermal

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

06/12/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-FABP5-1 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FABP5-1 Western Blot

Western Blot using CPTC-FABP5-1 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP5-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  NCI 60 Protein Array

CPTC-FABP5-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  Affinity Measurement by SPR
Download FABP5 pairing.pdf (793.1 KB)

Antibody Pairing Studies

This is a summary of antibody pairing studies by SPR.

Background

Catalog Number:

CPTC-FABP5-2

Target Antigen:

Fatty acid-binding protein, epidermal

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

05/14/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-FABP5-2 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FABP5-2 Western Blot

Western Blot using CPTC-FABP5-2 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP5-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-FABP5-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  Affinity Measurement by SPR
Download FABP5 pairing.pdf (793.1 KB)

Antibody Pairing Studies

This summarizes antibody pairing studies by SPR.

Background

Catalog Number:

CPTC-FABP5-3

Target Antigen:

Fatty acid-binding protein, epidermal

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/08/2012

Antigen Recognition(s):

recombinant full-length

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-FABP5-3 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-FABP5-3 Western Blot

Western Blot using CPTC-FABP5-3 as primary Ab against FABP5 (Ag 10280) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP5-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Affinity Measurement by SPR
Download FABP5 pairing.pdf (793.1 KB)

Antibody Pairing Studies

This summarizes antibody pairing studies by SPR.

Background

NCI Identification Number:

10280

Antigen Name:

Fatty acid-binding protein, epidermal

CPTC Name:

CPTC-FABP5

Keywords:

FABP5; E-FABP; EFABP; PA-FABP; PAFABP

Function:

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.

Chromosomal Localization:

8q21.13

Expression System:

E. Coli

NCBI Accession Number:

BC019385

Swiss Prot Accession Number:

Q01469

DNA Source:

HIP : HsCD00002133

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

14168

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITC
DGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQH
QEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Native Sequence:

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGK
NLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEW
DGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Calculated Isoelectric Point:

6.57

Molecular Weight:

15437

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click image to enlarge

Ag 10280

PAGE of Ag 10280 with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com