Fatty Acid-Binding Protein, Intestinal


Background

Catalog Number:

CPTC-FABP2-1

RRID:

AB_10658155

Target Antigen:

Fatty Acid-Binding Protein, Intestinal

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (107.7 KB)

CPTC-FABP2-1

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-FABP2-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-FABP2-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Human assay: A-431 fixed with PFA, dilution: 1:50
Human assay: U-2 OS fixed with PFA, dilution: 1:50
Human assay: U-251 MG fixed with PFA, dilution: 1:50 Click image to enlarge

CPTC-FABP2-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is partly supported by literature or no literature is available. Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Human assay: A-431 fixed with PFA, dilution: 1:50
Human assay: U-2 OS fixed with PFA, dilution: 1:50
Human assay: U-251 MG fixed with PFA, dilution: 1:50


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP2-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-FABP2-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FABP2-1 as primary Ab against rAg 10977 (FABP2) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-FABP2-1 Western blot

Result: Positive

Western Blot using CPTC-FABP2-1 as primary Ab against rAg 10977 (FABP2) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

Catalog Number:

CPTC-FABP2-2

RRID:

AB_10660831

Target Antigen:

Fatty Acid-Binding Protein, Intestinal

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (95.3 KB)

CPTC-FABP2-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-FABP2-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-FABP2-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Human assay: A-431 fixed with PFA, dilution: 1:125
Human assay: U-2 OS fixed with PFA, dilution: 1:125
Human assay: U-251 MG fixed with PFA, dilution: 1:125 Click image to enlarge

CPTC-FABP2-2 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Human assay: A-431 fixed with PFA, dilution: 1:125
Human assay: U-2 OS fixed with PFA, dilution: 1:125
Human assay: U-251 MG fixed with PFA, dilution: 1:125


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-FABP2-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-FABP2-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-FABP2-2 as primary Ab against rAg 10977 (FABP2) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-FABP2-2 Western blot

Result: Positive

Western Blot using CPTC-FABP2-2 as primary Ab against rAg 10977 (FABP2) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).


Background

NCI Identification Number:

10977

Antigen Name:

Fatty Acid-Binding Protein, Intestinal

CPTC Name:

CPTC-FABP2

Keywords:

FABPI; I-FABP; MGC133132

Function:

The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids.

They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance.

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis.

Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.

Chromosomal Localization:

4q28 - q31

Expression System:

E. Coli

NCBI Accession Number:

BC069625.1

UniProt Accession Number:

P12104

DNA Source:

OB : MHS1010-98684774

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

16960

Buffers:

PBS

Expressed Sequence:

SNAMAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNK
FTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRT
DNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Native Sequence:

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTV
KESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNG
NELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Calculated Isoelectric Point:

6.62

Molecular Weight:

15.21

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10977 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-FABP2 PAGE

PAGE of Ag 10977 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com