Ezrin (p81)


Background

Catalog Number:

CPTC-Ezrin-1

RRID:

AB_2100318

Target Antigen:

Ezrin (p81)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2021

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (110.7 KB)

CPTC-Ezrin-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-Erzin-1 for NCI60  Cell Line Array at titer 1:4000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-Ezrin-1 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-Erzin-1 for NCI60 Cell Line Array at titer 1:4000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-Ezrin-1. Titer: 1:4000 Click image to enlarge

CPTC-Ezrin-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-Ezrin-1. Titer: 1:4000


  Immunofluorescence - HPA
Click to enlarge image Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. uman assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000 Click image to enlarge

CPTC-Ezrin-1 Evaluation by the Human Protein Atlas

Result: Positive

Results provided by the Human Protein Atlas (www.proteinatlas.org). The subcellular location is supported by literature. Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane. uman assay: A-431 fixed with PFA, dilution: 1:2000
Human assay: U-2 OS fixed with PFA, dilution: 1:2000
Human assay: U-251 MG fixed with PFA, dilution: 1:2000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Ezrin-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Erzin-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Click image to enlarge

CPTC-Ezrin-1 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-Erzin-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.


  Western Blot - Cell Lysate
Click to enlarge image Western Blot using CPTC-Ezrin-1 as primary Ab against cell lysate from OVCAR-3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Ezrin-1 Cell Lysate Western blot

Result: Positive

Western Blot using CPTC-Ezrin-1 as primary Ab against cell lysate from OVCAR-3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-Erzin-1 as primary Ab against Ag 10474 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Ezrin-1 Western Blot

Result: Positive

Western Blot using CPTC-Erzin-1 as primary Ab against Ag 10474 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10474

Antigen Name:

Ezrin (p81)

CPTC Name:

CPTC-Ezrin

Aliases:

EZR; CVIL; CVL; Cytovillin; DKFZp762H157; FLJ26216; MGC1584; OTTHUMP00000017506; OTTHUMP00000017507; VIL2; Villin-2; ezrin; p81

Function:

The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene.
Alternatively spliced variants have also been described for this gene. Probably involved in connections of major cytoskeletal structures to the plasma membrane.

In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.

Chromosomal Localization:

P15311

Expression System:

E. Coli

Accession Number:

BC013903

UniProt Accession Number:

P15311

DNA Source:

HIP:HsCD00041738

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

66873

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGL
HYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDI
TQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYL
SSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQD
LEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRN
ISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKP
DTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEEL
MLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAAL
RAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQH
RAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPT
GYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKR
THNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL

Native Sequence:

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYV
DNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQK
LFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSE
RLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEM
YGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISF
NDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAK
EELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAK
EAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYS
AELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHN
DIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL

Calculated Isoelectric Point:

5.94

Molecular Weight:

69685

Last Updated:

09/01/2008

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10474 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10474 PAGE

PAGE of Ag 10474 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com