Catalog Number:
CPTC-EGFR-12
RRID:
AB_2827846
Target Antigen:
Epidermal Growth Factor Receptor Peptide 5
Isotype:
IgG
Species:
Rabbit Monoclonal Antibody
Last Updated:
04/19/2024
Antigen Recognition(s):
Peptide, Phosphorylation
Thematic Panel(s):
Ras Pathway
Result: Negative
Results provided by the Human Protein Atlas (www.proteinatlas.org).
Result: Positive
iMRM screening results for clone CPTC-EGFR-12. The clone is able to selectively pull down the target peptide CPTC-EGFR Peptide 4, YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPKP.
Result: Negative
Results provided by the Human Protein Atlas (www.proteinatlas.org).
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Negative
Western blot using CPTC-EGFR-12 of recombinant EGFR in over-expressed lysate. The antibody is not able to detect the target protein. Expected MW is 134 KDa.
Result: Negative
Western blot using CPTC-EGFR-12 as primary antibody against the whole cell lysates of A498, ACHN, H226, H322M, CCRF-CEM and HL-60. The antibody is not able to detect the target protein in any of the tested cell lines.
Catalog Number:
CPTC-EGFR-13
RRID:
AB_2827845
Target Antigen:
Epidermal Growth Factor Receptor Peptide 5
Isotype:
IgG
Species:
Rabbit Monoclonal Antibody
Last Updated:
04/19/2024
Antigen Recognition(s):
Peptide, Recombinant Full-length, Phosphorylation
Thematic Panel(s):
Ras Pathway
Result: Negative
Results provided by the Human Protein Atlas (www.proteinatlas.org).
Result: Positive
iMRM screening results for clone CPTC-EGFR-13. The clone is able to pull down not only the target peptide (panel 1, CPTC-EGFR Peptide 4, YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPKP), but also the two following peptides:
non-phosphorylated peptide (YSSDPTGALTEDSIDDTFLPVPEYINQSVPK, panel 2)
phosphorylated peptide ((pY)SSDPTGALTEDSIDDTFLPVPEYINQSVPK. panel 3).
Data provided by the Paulovich Lab, Fred Hutch (https://research.fredhutch.org/paulovich/en.html)
Result: Negative
Results provided by the Human Protein Atlas (www.proteinatlas.org).
Result: Negative
This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.
Result: Positive
Western blot using CPTC-EGFR-13 of recombinant EGFR in over-expressed lysate. The antibody is able to detect the target protein. Expected MW is 134 KDa.
NCI Identification Number:
00116
Antigen Name:
Epidermal Growth Factor Receptor Peptide 5
CPTC Name:
CPTC-EGFR Peptide 5
Aliases:
Epidermal Growth Factor Receptor; Receptor Tyrosine-Protein Kinase ErbB-1; Erb-B2 Receptor Tyrosine Kinase 1; Proto-Oncogene C-ErbB-1; EC 2.7.10.1; ERBB; HER1; ERBB1; Epidermal Growth Factor Receptor (Avian Erythroblastic Leukemia Viral (V-Erb-B) Oncogene Homolog); Erythroblastic Leukemia Viral (V-Erb-B) Oncogene Homolog (Avian); Avian Erythroblastic Leukemia Viral (V-Erb-B) Oncogene Homolog; Cell Proliferation-Inducing Protein 61; Cell Growth Inhibiting Protein 40; EC 2.7.10; NISBD2; PIG61; MENA
Function:
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.
EGFR (Epidermal Growth Factor Receptor) is a Protein Coding gene. Diseases associated with EGFR include lung cancer and inflammatory skin and bowel disease, neonatal, 2. Among its related pathways are PI3K-Akt signaling pathway and PI-3K cascade. GO annotations related to this gene include identical protein binding and chromatin binding. An important paralog of this gene is TNK1.
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade. Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling. Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin. Isoform 2 may act as an antagonist of EGF action.
The epidermal growth factor receptor (EGFR) is a receptor tyrosine kinase of the ErbB family. Four members of the ErbB family have been identified; EGFR (ErbB1, HER1), ErbB2 (HER2), ErbB3 (HER3) and ErbB4 (HER4). EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation. Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation.
Chromosomal Localization:
7p12
Accession Number:
NP_005219.2
UniProt Accession Number:
P00533
DNA Source:
N/A
Immunogen:
Vector Name:
N/A
Extinction Coefficient:
Buffers:
Expressed Sequence:
YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPK
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
3410
Last Updated:
09/17/2015
No SOPs available.
Get it for free at Adobe.com