PRINT

Epidermal Growth Factor Receptor Peptide 5

Antibody: CPTC-EGFR-12
Background

Catalog Number:

CPTC-EGFR-12

RRID:

AB_2827846

Target Antigen:

Epidermal Growth Factor Receptor Peptide 5

Isotype:

IgG

Species:

Rabbit Monoclonal Antibody

Last Updated:

07/19/2024

Antigen Recognition(s):

Peptide, Phosphorylation

Thematic Panel(s):

Ras Pathway

Purchase
Publications
Characterization Data [Compare Characterization Data]
  IHC HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (483.6 KB)

CPTC-EGFR-12 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  Immuno-MRM
Click to enlarge image iMRM screening results for clone CPTC-EGFR-12. The clone is able to selectively pull down the target peptide CPTC-EGFR Peptide 4, YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPKP. Click image to enlarge

CPTC-EGFR-12 iMRM (synthetic peptide)

Result: Positive

iMRM screening results for clone CPTC-EGFR-12. The clone is able to selectively pull down the target peptide CPTC-EGFR Peptide 4, YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPKP.


Characterization SOP Files

  Immunofluorescence

CPTC-EGFR-12 Immunofluorescence

Result: Negative

Immunofluorescence staining using CPTC-EGFR-12 as primary antibody against HL-60 and NCI H226 cells. EGFR protein expression shows no localization in either cell lines.


Characterization SOP Files

  Immunofluorescence - HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (483.6 KB)

CPTC-EGFR-12 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  NCI 60 Protein Array

CPTC-EGFR-12 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate

CPTC-EGFR-12 Western Blot (over-expressed lysate)

Result: Negative

Western blot using CPTC-EGFR-12 of recombinant EGFR in over-expressed lysate. The antibody is not able to detect the target protein. Expected MW is 134 KDa.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate

CPTC-EGFR-12 - SW recombinant protein

Result: Negative

SW using CPTC-EGFR-12 as primary antibody against the over-expressed lysate of EGFR. The antibody is not able to recognize the recombinant protein.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate

CPTC-EGFR-12 Western Blot (Cell lysates)

Result: Negative

Western blot using CPTC-EGFR-12 as primary antibody against the whole cell lysates of A498, ACHN, H226, H322M, CCRF-CEM and HL-60. The antibody is not able to detect the target protein in any of the tested cell lines.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate

CPTC-EGFR-12 Single Cell Western Blot (Cell Lysate)

Result: Negative

Single cell western blot using CPTC-EGFR-12 as a primary antibody against HL-60 and NCI H226 cell lysates. EGFR protein expression was not detected in either cell lysates.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate

CPTC-EGFR-12 - SW cell lysates

Result: Negative

SW using CPTC-EGFR-12 as primary antibody against the whole lysates of A498, ACHN, H226, H322M, CCRF-CEM and HL-60. The antibody is not able to recognize the endogenous protein in any of the tested lysates.


Characterization SOP Files

[top]

Antibody: CPTC-EGFR-13
Background

Catalog Number:

CPTC-EGFR-13

RRID:

AB_2827845

Target Antigen:

Epidermal Growth Factor Receptor Peptide 5

Isotype:

IgG

Species:

Rabbit Monoclonal Antibody

Last Updated:

07/19/2024

Antigen Recognition(s):

Peptide, Recombinant Full-length, Endogenous, Phosphorylation

Thematic Panel(s):

Ras Pathway

Purchase
Publications
Characterization Data [Compare Characterization Data]
  IHC HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (487.1 KB)

CPTC-EGFR-13 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  IHC Tissue
Click to enlarge image Tissue Micro-Array (TMA) core of colon cancer showing cytoplasmic and membranous staining using Antibody CPTC-EGFR-13. Titer: 1:250 Click image to enlarge

CPTC-EGFR-13 IHC Tissue

Result: Positive

Tissue Micro-Array (TMA) core of colon cancer showing cytoplasmic and membranous staining using Antibody CPTC-EGFR-13. Titer: 1:250


Characterization SOP Files

  Immuno-MRM
Click to enlarge image iMRM screening results for clone CPTC-EGFR-13. The clone is able to pull down not only the target peptide (panel 1, CPTC-EGFR Peptide 4, YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPKP), but also the two following peptides: non-phosphorylated peptide (YSSDPTGALTEDSIDDTFLPVPEYINQSVPK, panel 2) phosphorylated peptide ((pY)SSDPTGALTEDSIDDTFLPVPEYINQSVPK. panel 3). Data provided by the Paulovich Lab, Fred Hutch (https://research.fredhutch.org/paulovich/en.html) Click image to enlarge

CPTC-EGFR-13 iMRM (synthetic peptide)

Result: Positive

iMRM screening results for clone CPTC-EGFR-13. The clone is able to pull down not only the target peptide (panel 1, CPTC-EGFR Peptide 4, YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPKP), but also the two following peptides:
non-phosphorylated peptide (YSSDPTGALTEDSIDDTFLPVPEYINQSVPK, panel 2)
phosphorylated peptide ((pY)SSDPTGALTEDSIDDTFLPVPEYINQSVPK. panel 3).

Data provided by the Paulovich Lab, Fred Hutch (https://research.fredhutch.org/paulovich/en.html)


Characterization SOP Files

  Immunofluorescence

CPTC-EGFR-13 Immunofluorescence

Result: Negative

Immunofluorescence staining using CPTC-EGFR-13 as primary antibody against HL-60 and NCI H226 cells. EGFR protein expression shows no localization in either cell lines.


Characterization SOP Files

  Immunofluorescence - HPA
Download Results provided by the Human Protein Atlas (www.proteinatlas.org). (487.1 KB)

CPTC-EGFR-13 evaluation by the Human Protein Atlas

Result: Negative

Results provided by the Human Protein Atlas (www.proteinatlas.org).


Characterization SOP Files

  NCI 60 Protein Array

CPTC-EGFR-13 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image Western blot using CPTC-EGFR-13 of recombinant EGFR in over-expressed lysate. The antibody is able to detect the target protein. Expected MW is 134 KDa. Click image to enlarge

CPTC-EGFR-13 Western Blot (over-expressed lysate)

Result: Positive

Western blot using CPTC-EGFR-13 of recombinant EGFR in over-expressed lysate. The antibody is able to detect the target protein. Expected MW is 134 KDa.


Characterization SOP Files

  Western Blot - Over-expressed transient protein in cell lysate
Click to enlarge image SW using CPTC-EGFR-13 as primary antibody against the over-expressed lysate of EGFR. The antibody is able to recognize the recombinant protein. Click image to enlarge

CPTC-EGFR-13 - SW recombinant protein

Result: Positive

SW using CPTC-EGFR-13 as primary antibody against the over-expressed lysate of EGFR. The antibody is able to recognize the recombinant protein.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate

CPTC-EGFR-13 Single Cell Western Blot (Cell Lysate)

Result: Negative

Single cell western blot using CPTC-EGFR-13 as a primary antibody against HL-60 and NCI H226 cell lysates. EGFR protein expression was not detected in either cell lysates.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image SW using CPTC-EGFR-13 as primary antibody against the whole lysates of A498, ACHN, H226, H322M, CCRF-CEM and HL-60. The antibody is able to recognize the endogenous protein in A498, ACHN and H226. Click image to enlarge

CPTC-EGFR-13 - SW cell lysates

Result: Positive

SW using CPTC-EGFR-13 as primary antibody against the whole lysates of A498, ACHN, H226, H322M, CCRF-CEM and HL-60. The antibody is able to recognize the endogenous protein in A498, ACHN and H226.


Characterization SOP Files

  Western Blot - Tissue or Cell Lysate
Click to enlarge image SW using CPTC-EGFR-13 as primary antibody against the whole lysates of WT HeLa and correpondent EGFR KO HeLa. The antibody is able to recognize the endogenous protein onlyin WT HeLa as expected. Click image to enlarge

CPTC-EGFR-13 - SW KO/WT cell lysates

Result: Positive

SW using CPTC-EGFR-13 as primary antibody against the whole lysates of WT HeLa and correpondent EGFR KO HeLa. The antibody is able to recognize the endogenous protein onlyin WT HeLa as expected.


Characterization SOP Files

[top]

Antigen: Epidermal Growth Factor Receptor Peptide 5
Background

NCI Identification Number:

00116

Antigen Name:

Epidermal Growth Factor Receptor Peptide 5

CPTC Name:

CPTC-EGFR Peptide 5

Aliases:

Epidermal Growth Factor Receptor; Receptor Tyrosine-Protein Kinase ErbB-1; Erb-B2 Receptor Tyrosine Kinase 1; Proto-Oncogene C-ErbB-1; EC 2.7.10.1; ERBB; HER1; ERBB1; Epidermal Growth Factor Receptor (Avian Erythroblastic Leukemia Viral (V-Erb-B) Oncogene Homolog); Erythroblastic Leukemia Viral (V-Erb-B) Oncogene Homolog (Avian); Avian Erythroblastic Leukemia Viral (V-Erb-B) Oncogene Homolog; Cell Proliferation-Inducing Protein 61; Cell Growth Inhibiting Protein 40; EC 2.7.10; NISBD2; PIG61; MENA

Function:

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.

EGFR (Epidermal Growth Factor Receptor) is a Protein Coding gene. Diseases associated with EGFR include lung cancer and inflammatory skin and bowel disease, neonatal, 2. Among its related pathways are PI3K-Akt signaling pathway and PI-3K cascade. GO annotations related to this gene include identical protein binding and chromatin binding. An important paralog of this gene is TNK1.

Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade. Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling. Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin. Isoform 2 may act as an antagonist of EGF action.

The epidermal growth factor receptor (EGFR) is a receptor tyrosine kinase of the ErbB family. Four members of the ErbB family have been identified; EGFR (ErbB1, HER1), ErbB2 (HER2), ErbB3 (HER3) and ErbB4 (HER4). EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation. Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation.

Chromosomal Localization:

7p12

Accession Number:

NP_005219.2

UniProt Accession Number:

P00533

DNA Source:

N/A

Immunogen:

Vector Name:

N/A

Extinction Coefficient:

Buffers:

Expressed Sequence:

YSSDPTGALTEDSIDDTFLPVPE(pY)INQSVPK

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

3410

Last Updated:

09/17/2015

Links

Characterization Data

SOPs

No SOPs available.

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]