PRINT

Calcyclin (Prolactin Receptor Associated Protein)

Antibody: CPTC-Calcyclin-1
Background

Catalog Number:

CPTC-Calcyclin-1

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-Calcyclin-1 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-1 Western Blot

Western Blot using CPTC-Calcyclin-1 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3).

Characterization SOP Files

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-Calcyclin-1 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-1 Cell Lysate blot

Western Blot using CPTC-Calcyclin-1 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Calcyclin Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Calcylin is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Calcylin NCI 60 Protein Array

Protein Array in which CPTC-Calcylin is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Characterization SOP Files

  IHC NCI60

CPTC-Calcyclin-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-Calcyclin-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Characterization SOP Files

[top]

Antibody: CPTC-Calcyclin-2
Background

Catalog Number:

CPTC-Calcyclin-2

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-Calcyclin-2 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-2 Western Blot

Western Blot using CPTC-Calcyclin-2 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as positive control (lane 3).

Characterization SOP Files

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-Calcyclin-2 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-2 Cell Lysate Western blot

Western Blot using CPTC-Calcyclin-2 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Calcyclin-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Calcyclin-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Calcyclin-2 NCI60 Protein Array

Protein Array in which CPTC-Calcyclin-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Characterization SOP Files

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-S100A4-3 for NCI60 Cell Line Array at titer 1:250 0=NEGATIVE 1=WEAK 2=MODERATE 3=STRONG Click image to enlarge

CPTC-Calcyclin-2 IHC NCI60

Immuno-histochemistry of CPTC-S100A4-3 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK
2=MODERATE
3=STRONG

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example

Characterization SOP Files

[top]

Antibody: CPTC-Calcyclin-3
Background

Catalog Number:

CPTC-Calcyclin-3

Target Antigen:

Calcyclin (Prolactin Receptor Associated Protein)

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-Calcyclin-3 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3). Click image to enlarge

CPTC-Calcyclin-3 Western blot

Western Blot using CPTC-Calcyclin-3 as primary Ab against Ag 10268 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as a positive control (lane 3).

Characterization SOP Files

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-Calcyclin-3 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Calcyclin-3 Cell Lysate Western blot

Western Blot using CPTC-Calcyclin-3 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA

CPTC-Calcyclin-3 Indirect ELISA

This antibody is not suitable for use in an Indirect ELISA format

Characterization SOP Files

  NCI 60 Protein Array

CPTC-Calcyclin-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Characterization SOP Files

  IHC NCI60

CPTC-Calcyclin-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example

Characterization SOP Files

  IHC Tissue

CPTC-Calcyclin-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Characterization SOP Files

  IHC HPA
Download CPTC-Calcyclin-3.pdf (105.6 KB)

CPTC-Calcylin-3 Evaluation by Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

[top]

Antigen: Calcyclin (Prolactin Receptor Associated Protein)
Background

NCI Identification Number:

10268

Antigen Name:

Calcyclin (Prolactin Receptor Associated Protein)

CPTC Name:

CPTC-Calcyclin

Keywords:

Calcylin, S100A6; S100 calcium binding protein A6; 2A9; 5B10; CABP; CACY; OTTHUMP00000015472; OTTHUMP00000015473; PRA

Function:

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Chromosomal Localization:

1q21

Expression System:

E. Coli

NCBI Accession Number:

BC001431

Swiss Prot Accession Number:

P06703

DNA Source:

HIP:HsCD00002783

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4470

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSK
LQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Native Sequence:

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD
AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Calculated Isoelectric Point:

5.32

Molecular Weight:

10452

Last Updated:

04/09/2013

Links

Characterization Data

Gel

Click to enlarge image Western Blot using CPTC-Calcyclin-3 as primary Ab against cell lysate from SK-OV3 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click image to enlarge

CPTC-Calcyclin (rAg 10268) PAGE

PAGE of Calcyclin (rAg 10268) with molecular weight standards in lane 1.

SOPs

[top]

Don't have Adobe Reader™?

Get it for free at Adobe.com

  [top]