chemokine (C-X-C motif) ligand 9


Background

Catalog Number:

CPTC-CXCL9-1

Target Antigen:

chemokine (C-X-C motif) ligand 9

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-CXCL9-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CXCL9-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CXCL9-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


  NCI 60 Protein Array

CPTC-CXCL9-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CXCL9-1 as primary Ab against CXCL9 (rAg 11056) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CXCL9-1 Western blot

Result: Positive

Western Blot using CPTC-CXCL9-1 as primary Ab against CXCL9 (rAg 11056) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

11056

Antigen Name:

chemokine (C-X-C motif) ligand 9

CPTC Name:

CPTC-CXCL9

Keywords:

chemokine (C-X-C motif) ligand 9; SCYB9; MIG: Humig; crg-10; monokine induced by gamma interferon; Gamma-interferon-induced monokine; Monokine induced by interferon-gamma, Small-inducible cytokine B9; CMK; C-X-C motif chemokine 9; HuMIG

Function:

The function of this gene has not been specifically defined; however, it is thought to be involved in T cell
trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of
cytokines.

Cytokine that affects the growth, movement, or activation state of cells that participate in immune and
inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3

Chromosomal Localization:

4q21

Expression System:

E. Coli

NCBI Accession Number:

BC063122.1

Swiss Prot Accession Number:

Q07325

DNA Source:

OpenBiosystems - MHS1011-9199261

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

5625

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNATPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKN
GVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRS
RQKKTT

Native Sequence:

MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLK
QFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQK
NGKKHQKKKVLKVRKSQRSRQKKTT

Calculated Isoelectric Point:

10.34

Molecular Weight:

11997

Last Updated:

11/13/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of CXCL9 (rAg 11056) with molecular weight standards in lane 1
Click image to enlarge

CPTC-CXCL9 PAGE

PAGE of CXCL9 (rAg 11056) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com