Cystatin A


Background

Catalog Number:

CPTC-CSTA-1

Target Antigen:

Cystatin A

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CSTA-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CSTA-1 as primary Ab against rAg 10991 (CSTA) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-CSTA-1 Western blot

Western Blot using CPTC-CSTA-1 as primary Ab against rAg 10991 (CSTA) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  NCI 60 Protein Array

CPTC-CSTA-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (105.7 KB)

CPTC-CSTA-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  IHC Tissue

CPTC-CSTA-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-CSTA-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-CSTA-2

Target Antigen:

Cystatin A

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

04/29/2014

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CSTA-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CSTA-2 as primary Ab against rAg 10991 (CSTA) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-CSTA-2 Western blot

Western Blot using CPTC-CSTA-2 as primary Ab against rAg 10991 (CSTA) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  NCI 60 Protein Array

CPTC-CSTA-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (99.5 KB)

CSTA-CSTA-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  IHC Tissue

CSTA-CSTA-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CSTA-CSTA-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-CSTA-3

Target Antigen:

Cystatin A

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/07/2013

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CSTA-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CSTA-3 as primary Ab against rAg 10991 (CSTA) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-CSTA-3 Western blot

Western Blot using CPTC-CSTA-3 as primary Ab against rAg 10991 (CSTA) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  NCI 60 Protein Array

CPTC-CSTA-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (96.0 KB)

CPTC-CSTA-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  IHC Tissue

CPTC-CSTA-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-CSTA-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10991

Antigen Name:

Cystatin A

CPTC Name:

CPTC-CSTA

Keywords:

Cystatin-AS; STF1; STFA; Stefin-A

Function:

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. This is an intracellular thiol proteinase inhibitor.

Chromosomal Localization:

3q21

Expression System:

E. Coli

NCBI Accession Number:

BC010379.1

Swiss Prot Accession Number:

P01040

DNA Source:

OB : MHS1011-74586

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

8940

Buffers:

PBS

Expressed Sequence:

SNAMIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQV
VAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTG
F

Native Sequence:

MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAG
TNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Calculated Isoelectric Point:

5.38

Molecular Weight:

11.01

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10991 (with molecular weight standards in lane 1)
Click image to enlarge

CPTC-Cystatin A PAGE

PAGE of Ag 10991 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com