Carboxypeptidase E (mouse)


Background

Catalog Number:

CPTC-CPE-1

Target Antigen:

Carboxypeptidase E (mouse)

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

01/25/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CPE-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  Western Blot
Click to enlarge image Western blot of CPTC-CPE-1 antibody with full length CPE recombinant protein (NCI ID#00236). Click image to enlarge

CPTC-CPE-1 Western blot

Western blot of CPTC-CPE-1 antibody with full length CPE recombinant protein (NCI ID#00236).

Characterization SOP Files

Background

Catalog Number:

CPTC-CPE-2

Target Antigen:

Carboxypeptidase E (mouse)

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

01/25/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CPE-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  Western Blot
Click to enlarge image Western blot of CPTC-CPE-2 antibody with full length CPE recombinant protein (NCI ID#00236). Click image to enlarge

CPTC-CPE-2 Western blot

Western blot of CPTC-CPE-2 antibody with full length CPE recombinant protein (NCI ID#00236).

Characterization SOP Files

Background

Catalog Number:

CPTC-CPE-3

Target Antigen:

Carboxypeptidase E (mouse)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/25/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CPE-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  Western Blot
Click to enlarge image Western blot of CPTC-CPE-3 antibody with full length CPE recombinant protein (NCI ID#00236). Click image to enlarge

CPTC-CPE-3 Western blot

Western blot of CPTC-CPE-3 antibody with full length CPE recombinant protein (NCI ID#00236).

Characterization SOP Files

Background

NCI Identification Number:

00236

Antigen Name:

Carboxypeptidase E (mouse)

CPTC Name:

CPTC-CPE

Keywords:

Carboxypeptidase E; Enkephalin Convertase; Carboxypeptidase H; Cobalt-Stimulated Chromaffin Granule Carboxypeptidase; Insulin Granule-Associated Carboxypeptidase; Prohormone-Processing Carboxypeptidase; EC 3.4.17.10; CPH; EC 3.4.17

Function:

This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes.

CPE (Carboxypeptidase E) is a Protein Coding gene. Diseases associated with CPE include Hyperproinsulinemia and Phlebotomus Fever. Among its related pathways are Allograft rejection and Peptide hormone metabolism. GO annotations related to this gene include cell adhesion molecule binding and carboxypeptidase activity. An important paralog of this gene is CPD.

Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.

Chromosomal Localization:

4q32.3

Expression System:

Baculovirus

NCBI Accession Number:

x

Swiss Prot Accession Number:

x

DNA Source:

N/A

Immunogen:

Recombinant Full Length Protein

Vector Name:

Not provided

Extinction Coefficient:

Buffers:

PBS, pH 7.2

Expressed Sequence:

MAGRGGRVLLALCAALVAGGWLLTAEAQEPGAPAAGMRRRRRLQQEDGIS
FEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVH
EPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTR
IHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYV
NEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLHGG
DLVANYPYDETRSGTAHEYSSCPDDAIFQSLARAYSSFNPVMSDPNRPPC
RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPP
EETLKSYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVDGIDH
DVTSAKDGDYWRLLAPGNYKLTASAPGYLAITKKVAVPFSPAVGVDFELE
SFSERKEEEKEELMEWWKMMSETLNFHHHHHH

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

53000

Last Updated:

02/13/2018

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com