Chloride Intracellular Channel 1


Background

Catalog Number:

CPTC-CLIC1-1

Target Antigen:

Chloride Intracellular Channel 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2013

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CLIC1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CLIC1-1 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CLIC1-1 Western Blot

Western Blot using CPTC-CLIC1-1 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-CLIC1-1 for NCI60  Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-CLIC1-1 IHC NCI60

Immuno-histochemistry of CPTC-CLIC1-1 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CLIC1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CLIC1-1 NCI60 Protein Array

Protein Array in which CPTC-CLIC1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-1. Titer: 1:250 Click image to enlarge

CPTC-CLIC1-1 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-1. Titer: 1:250

Background

Catalog Number:

CPTC-CLIC1-2

Target Antigen:

Chloride Intracellular Channel 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CLIC1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CLIC1-2 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CLIC1-2 Western Blot

Western Blot using CPTC-CLIC1-2 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CLIC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CLIC1-2 Protein Array

Protein Array in which CPTC-CLIC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-CLIC1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:250
Click image to enlarge

CPTC-CLIC1-2 IHC NCI60

Immunohistochemistry of CPTC-CLIC1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:250

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-2. Titer: 1:250 Click image to enlarge

CPTC-CLIC1-2 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-2. Titer: 1:250

Background

NCI Identification Number:

10458

Antigen Name:

Chloride Intracellular Channel 1

CPTC Name:

CPTC-CLIC1

Keywords:

CLIC1; G6; NCC27; OTTHUMP00000029131; OTTHUMP00000029133; OTTHUMP00000029137; OTTHUMP00000174486; hRNCC; p64CLCP

Function:

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes
including stabilization of cell membrane potential,transepithelial transport, maintenance of
intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Chromosomal Localization:

6p22.1 - p21.2

Expression System:

E. Coli

NCBI Accession Number:

NM_001288

Swiss Prot Accession Number:

O00299

DNA Source:

HIP:HsCD00001712

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

17608

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVD
TKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLA
ALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSP
LPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGF
TIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Native Sequence:

MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKR
RTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALN
PESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPE
EVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIP
EAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Calculated Isoelectric Point:

5.09

Molecular Weight:

27195

Last Updated:

04/09/2013

Links

Characterization Data

Gel

Click to enlarge image PAGE of CLIC1 (rAg 10458) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-CLIC1 (rAg 10458) PAGE

PAGE of CLIC1 (rAg 10458) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com