Chloride Intracellular Channel 1


Background

Catalog Number:

CPTC-CLIC1-1

Target Antigen:

Chloride Intracellular Channel 1

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immuno-histochemistry of CPTC-CLIC1-1 for NCI60  Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click image to enlarge

CPTC-CLIC1-1 IHC NCI60

Result: Positive

Immuno-histochemistry of CPTC-CLIC1-1 for NCI60 Cell Line Array at titer 1:250
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-1. Titer: 1:250 Click image to enlarge

CPTC-CLIC1-1 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-1. Titer: 1:250


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CLIC1-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CLIC1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CLIC1-1 NCI60 Protein Array

Result: Positive

Protein Array in which CPTC-CLIC1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CLIC1-1 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CLIC1-1 Western Blot

Result: Positive

Western Blot using CPTC-CLIC1-1 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CLIC1-2

Target Antigen:

Chloride Intracellular Channel 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60
Click to enlarge image Immunohistochemistry of CPTC-CLIC1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:250
Click image to enlarge

CPTC-CLIC1-2 IHC NCI60

Result: Positive

Immunohistochemistry of CPTC-CLIC1-2 for NCI60 Cell Line Array. Data scored as:
0=NEGATIVE
1=WEAK (red)
2=MODERATE (blue)
3=STRONG (green)
Titer: 1:250


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-2. Titer: 1:250 Click image to enlarge

CPTC-CLIC1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-CLIC1-2. Titer: 1:250


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CLIC1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-CLIC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-CLIC1-2 Protein Array

Result: Positive

Protein Array in which CPTC-CLIC1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CLIC1-2 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CLIC1-2 Western Blot

Result: Positive

Western Blot using CPTC-CLIC1-2 as primary Ab against Ag 10458 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10458

Antigen Name:

Chloride Intracellular Channel 1

CPTC Name:

CPTC-CLIC1

Keywords:

CLIC1; G6; NCC27; OTTHUMP00000029131; OTTHUMP00000029133; OTTHUMP00000029137; OTTHUMP00000174486; hRNCC; p64CLCP

Function:

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes
including stabilization of cell membrane potential,transepithelial transport, maintenance of
intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Chromosomal Localization:

6p22.1 - p21.2

Expression System:

E. Coli

NCBI Accession Number:

NM_001288

Swiss Prot Accession Number:

O00299

DNA Source:

HIP:HsCD00001712

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

17608

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVD
TKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLA
ALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSP
LPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGF
TIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Native Sequence:

MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKR
RTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALN
PESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPE
EVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIP
EAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Calculated Isoelectric Point:

5.09

Molecular Weight:

27195

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of CLIC1 (rAg 10458) with molecular weight standards in lane 1.
Click image to enlarge

CPTC-CLIC1 (rAg 10458) PAGE

PAGE of CLIC1 (rAg 10458) with molecular weight standards in lane 1.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com