Creatine kinase B chain


Background

Catalog Number:

CPTC-CKB-1

Target Antigen:

Creatine kinase B chain

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (104.3 KB)

CPTC-CKB-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-CKB-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CKB-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CKB-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-CKB-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CKB-1 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CKB-1 Western blot

Result: Positive

Western Blot using CPTC-CKB-1 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CKB-2

Target Antigen:

Creatine kinase B chain

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (104.0 KB)

CPTC-CKB-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-CKB-2 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CKB-2 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CKB-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-CKB-2 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CKB-2 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CKB-2 Western blot

Result: Positive

Western Blot using CPTC-CKB-2 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CKB-3

Target Antigen:

Creatine kinase B chain

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (99.8 KB)

CPTC-CKB-3 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-CKB-3 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-CKB-3 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CKB-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-CKB-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CKB-3 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CKB-3 Western blot

Result: Positive

Western Blot using CPTC-CKB-3 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10328

Antigen Name:

Creatine kinase B chain

CPTC Name:

CPTC-CKB

Keywords:

CKB; B-CK; CKBB; EC 2.7.3.2

Function:

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The
encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a
heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.

Chromosomal Localization:

14q32

Expression System:

E. Coli

NCBI Accession Number:

BC019281

Swiss Prot Accession Number:

P12277

DNA Source:

HIP:HsCD00004710

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

35535

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKST
PSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRH
GGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCS
RGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKP
VSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMK
EVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHI
KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEV
ELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Native Sequence:

MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSG
FTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGY
KPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGE
RRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSP
LLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVF
TRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELV
QMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Calculated Isoelectric Point:

5.34

Molecular Weight:

42917

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10328 with molecular weight standards (lane 1)
Click image to enlarge

Ag 10328

PAGE of Ag 10328 with molecular weight standards (lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com