Choline Kinase Alpha


Background

Catalog Number:

CPTC-CHKA-1

Target Antigen:

Choline Kinase Alpha

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

07/03/2014

Antigen Recognition(s):

Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-CHKA-1 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHKA-1 Western blot

Western Blot using CPTC-CHKA-1 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHKA-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-CHKA-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-CHKA-2

Target Antigen:

Choline Kinase Alpha

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

07/03/2014

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-CHKA-2 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHKA-2 Western blot

Western Blot using CPTC-CHKA-2 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHKA-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-CHKA-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

Catalog Number:

CPTC-CHKA-3

Target Antigen:

Choline Kinase Alpha

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

07/03/2014

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-CHKA-3 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CHKA-3 Western blot

Western Blot using CPTC-CHKA-3 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CHKA-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

  NCI 60 Protein Array

CPTC-CHKA-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

Background

NCI Identification Number:

00008

Antigen Name:

Choline Kinase Alpha

CPTC Name:

CPTC-CHKA

Keywords:

choline kinase alpha1; Ck; EK; CHK; CK1; choline kinase; Ethanolamine kinase; EC 2.7.1.32; CHETK-alpha; EC 2.7.1.82

Function:

The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded
by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes
the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.

Has a key role in phospholipid biosynthesis and may contribute to tumor cell growth. Catalyzes the first step in phosphatidylcholine biosynthesis. Contributes to phosphatidylethanolamine biosynthesis. Phosphorylates choline and
ethanolamine. Has higher activity with choline.

Chromosomal Localization:

11q13.2

Expression System:

E. coli

NCBI Accession Number:

NM_001277

Swiss Prot Accession Number:

P35790

DNA Source:

Mammalian Gene Collection

Immunogen:

Recombinant Domain

Vector Name:

pET28-LIC

Extinction Coefficient:

Buffers:

Expressed Sequence:

MGSSHHHHHHSSGLVPRGSpqppadeqpeprtrrraylwckeflpgawrg
lredefhisvirgglsnmlfqcslpdttatlgdeprkvllrlygailqmr
scnkegseqaqkenefqgaeamvlesvmfailaerslgpklygifpqgrl
eqfipsrrldteelslpdisaeiaekmatfhgmkmpfnkepkwlfgtmek
ylkevlrikfteesrikklhkllsynlplelenlrsllestpspvvfchn
dcqegnilllegrensekqklmlidfeyssynyrgfdignhfcewmydys
yekypffranirkyptkkqqlhfissylpafqndfenlsteeksiikeem
llevnrfalashflwglwsivqakissiefgymdyaqarfdayfhqkrkl
gv

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

46923

Last Updated:

12/02/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click image to enlarge

CPTC-CHKA PAGE

PAGE of CHKA (Ag 0008) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com