Cell division cycle 34 homolog (S. Cerevisiae)


Background

Catalog Number:

CPTC-CDC34-1

Target Antigen:

Cell division cycle 34 homolog (S. Cerevisiae)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (103.7 KB)

CPTC-CDC34-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CDC34-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CDC34-1 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CDC34-1 Western blot

Result: Positive

Western Blot using CPTC-CDC34-1 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-CDC34-2

Target Antigen:

Cell division cycle 34 homolog (S. Cerevisiae)

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (114.9 KB)

CPTC-CDC34-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CDC34-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CDC34-2 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CDC34-2 Western blot

Result: Positive

Western Blot using CPTC-CDC34-2 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10253

Antigen Name:

Cell division cycle 34 homolog (S. Cerevisiae)

CPTC Name:

CPTC-CDC34

Keywords:

CDC34; UBC3; UBE2R1; E2-CDC34; EC 6.3.2.19

Function:

The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins.

This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication.

Catalyzes the covalent attachment of ubiquitin to other proteins. May be involved in degradation of katenin.

Chromosomal Localization:

19p13.3

Expression System:

E. Coli

NCBI Accession Number:

BC018143

Swiss Prot Accession Number:

P49427

DNA Source:

HIP : HsCD00002069

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG19

Extinction Coefficient:

41433

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFG
PPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISIL
HPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVM
YRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAP
APDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES

Native Sequence:

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPN
TYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPP
VDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRK
WKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPD
EGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES

Calculated Isoelectric Point:

4.41

Molecular Weight:

27009

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10253 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10253

PAGE of Ag 10253 (with molecular weight standards in lane 1)

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com