Catalog Number:
CPTC-CDC34-1
RRID:
AB_2617230
Target Antigen:
Cell division cycle 34 homolog (S. Cerevisiae)
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
03/19/2025
Antigen Recognition(s):
Recombinant Full-length, Endogenous
Result: Positive
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Result: Positive
Western Blot using CPTC-CDC34-1 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Catalog Number:
CPTC-CDC34-2
RRID:
AB_2617231
Target Antigen:
Cell division cycle 34 homolog (S. Cerevisiae)
Isotype:
IgG1
Species:
Mouse Monoclonal Antibody
Last Updated:
03/19/2025
Antigen Recognition(s):
Recombinant Full-length, Endogenous
Result: Positive
This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)
Result: High Binding
Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Result: Positive
Western Blot using CPTC-CDC34-2 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
NCI Identification Number:
10253
Antigen Name:
Cell division cycle 34 homolog (S. Cerevisiae)
CPTC Name:
CPTC-CDC34
Aliases:
CDC34; UBC3; UBE2R1; E2-CDC34; EC 6.3.2.19
Function:
The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins.
This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication.
Catalyzes the covalent attachment of ubiquitin to other proteins. May be involved in degradation of katenin.
Chromosomal Localization:
19p13.3
Expression System:
E. Coli
Accession Number:
BC018143
UniProt Accession Number:
P49427
DNA Source:
HIP : HsCD00002069
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG19
Extinction Coefficient:
41433
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFG
PPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISIL
HPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVM
YRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAP
APDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
Native Sequence:
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPN
TYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPP
VDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRK
WKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPD
EGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
Calculated Isoelectric Point:
4.41
Molecular Weight:
27009
Last Updated:
09/01/2008
PAGE of Ag 10253 (with molecular weight standards in lane 1)
No SOPs available.
BL21 Competant Cells (25.5 KB)
Cloning, Expression, Purification Flow Chart (37.5 KB)
High Throughput cloning MCSG19 (71.5 KB)
High Throughput cloning MCSG7 (71.5 KB)
Minimal Media Protein Growth (58.0 KB)
Plasmid Purification (50.0 KB)
PRK1037 Competent Cells (25.5 KB)
Protein Purification using AKTA (76.5 KB)
Get it for free at Adobe.com