CD47 Molecule


Background

Catalog Number:

CPTC-CD47-1

RRID:

AB_2782987

Target Antigen:

CD47 Molecule

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

08/31/2020

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF provides the evaluation results as provided by the Human Protein Atlas (www.humanproteinatlas.org) (300.2 KB)

CPTC-CD47-1 Evaluation by the Human Protein Atlas

Result: Negative

This PDF provides the evaluation results as provided by the Human Protein Atlas (www.humanproteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CD47-1 Indirec ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CD47-1 as primary Ab against rec. CD47 (rAg 00271) (lane 2). Also included are molecular wt. standards (lane 1) Click image to enlarge

CPTC-CD47-1 Western blot

Result: Positive

Western Blot using CPTC-CD47-1 as primary Ab against rec. CD47 (rAg 00271) (lane 2). Also included are molecular wt. standards (lane 1)


Characterization SOP Files

Background

Catalog Number:

CPTC-CD47-2

RRID:

AB_2782988

Target Antigen:

CD47 Molecule

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

09/09/2020

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (316.4 KB)

CPTC-CD47-2 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CD47-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CD47-2 as primary Ab against rec. CD47 (rAg 00271) (lane 2). Also included are molecular wt. standards (lane 1) Click image to enlarge

CPTC-CD47-2 Western blot

Result: Positive

Western Blot using CPTC-CD47-2 as primary Ab against rec. CD47 (rAg 00271) (lane 2). Also included are molecular wt. standards (lane 1)


Characterization SOP Files

Background

Catalog Number:

CPTC-CD47-3

RRID:

AB_2782989

Target Antigen:

CD47 Molecule

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

09/10/2020

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (335.5 KB)

CPTC-CD47-3 Evaluation by the Human Protein Atlas

Result: Negative

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-CD47-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.


Characterization SOP Files

  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-CD47-3 as primary Ab against rec. CD47 (rAg 00271) (lane 2). Also included are molecular wt. standards (lane 1) Click image to enlarge

CPTC-CD47-3 Western blot

Result: Positive

Western Blot using CPTC-CD47-3 as primary Ab against rec. CD47 (rAg 00271) (lane 2). Also included are molecular wt. standards (lane 1)


Characterization SOP Files

Background

NCI Identification Number:

00271

Antigen Name:

CD47 Molecule

CPTC Name:

CPTC-CD47

Keywords:

CD47 Molecule; Antigenic Surface Determinant Protein OA3; CD47 Antigen (Rh-Related Antigen, Integrin-Associated Signal Transducer); Antigen Identified By Monoclonal Antibody 1D8; Leukocyte Surface Antigen CD47; Integrin Associated Protein; Rh-Related Antigen; CD47 Glycoprotein; MER6; IAP; Integrin-Associated Signal Transducer; Integrin-Associated Protein; CD47 Antigen; Protein MER6; OA3; Leukocyte Surface Antigen CD47 2 3 4 IAP; CD47

Function:

This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.

CD47 (CD47 Molecule) is a Protein Coding gene. Diseases associated with CD47 include Hereditary Spherocytosis and Neonatal Meningitis. Among its related pathways are Integrin Pathway and Integrins in angiogenesis. Gene Ontology (GO) annotations related to this gene include thrombospondin receptor activity.

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.

Chromosomal Localization:

3q13.12

Expression System:

Mammalian

NCBI Accession Number:

NP_001768.1

UniProt Accession Number:

Q08722

DNA Source:

N/A

Immunogen:

Recombinant Domain

Vector Name:

N/A

Extinction Coefficient:

Buffers:

Expressed Sequence:

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTF
DGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTE
LTREGETIIELKYRVVSWFSP (fused to Domains 3 & 4 Of R
at Cd4) STSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSSQ
SWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTL
TLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEAR
VSRQEKVIQVQAPEAGVWQCLLSEGEEVKMDSKIQVLSKGLN

Native Sequence:

Calculated Isoelectric Point:

0

Molecular Weight:

40000

Last Updated:

09/02/2020

Links

Characterization Data

SOPs

No SOPs available.

Don't have Adobe Reader™?

Get it for free at Adobe.com