Carbonic anhydrase VIII


Background

Catalog Number:

CPTC-CA8-1

Target Antigen:

Carbonic anhydrase VIII

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CA8-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CA8-1 as primary Ab against Ag 10903 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CA8-1 Western blot

Western Blot using CPTC-CA8-1 as primary Ab against Ag 10903 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  NCI 60 Protein Array

CPTC-CA8-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (93.2 KB)

CPTC-CA8-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

  IHC Tissue

CPTC-CA8-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC NCI60

CPTC-CA8-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-CA8-2

Target Antigen:

Carbonic anhydrase VIII

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

01/24/2013

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-CA8-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Western Blot
Click to enlarge image Western Blot using CPTC-CA8-2 as primary Ab against Ag 10903 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-CA8-2 Western blot

Western Blot using CPTC-CA8-2 as primary Ab against Ag 10903 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (110.6 KB)

CPTC-CA8-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10903

Antigen Name:

Carbonic anhydrase VIII

CPTC Name:

CPTC-CA8

Keywords:

CA-VIII; CALS; CARP; MGC120502; MGC99509

Function:

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form.

Does not have a carbonic anhydrase catalytic activity.

Chromosomal Localization:

8q11 - q12

Expression System:

E. Coli

NCBI Accession Number:

BC108929.2

Swiss Prot Accession Number:

P35219

DNA Source:

OB : MHS4426-99622804

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

46535

Buffers:

PBS

Expressed Sequence:

SNAMADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGE
YQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKS
VLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNS
TLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKT
IPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQI
EEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Native Sequence:

MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQS
PINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLS
GGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLF
GSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPC
FNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEF
RRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Calculated Isoelectric Point:

4.78

Molecular Weight:

32.97

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10903(with molecular weight standards in lane 1)
Click image to enlarge

CPTC-CA8 PAGE

PAGE of Ag 10903(with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com