BCL2-like 2


Background

Catalog Number:

CPTC-BCL2L2-1

Target Antigen:

BCL2-like 2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-BCL2L2-1 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-BCL2L2-1 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-BCL2L2-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NAPPA
Download This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique. (1.4 MB)

Evaluation of antibody by NAPPA

Result: Positive

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-BCL2L2-1 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-BCL2L2-1 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-BCL2L2-1 Western Blot

Result: Positive

Western Blot using CPTC-BCL2L2-1 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-BCL2L2-2

Target Antigen:

BCL2-like 2

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-BCL2L2-2 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-BCL2L2-2 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-BCL2L2-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array

CPTC-BCL2L2-2 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-BCL2L2-2 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-BCL2L2-2 Western Blot

Result: Positive

Western Blot using CPTC-BCL2L2-2 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

Catalog Number:

CPTC-BCL2L2-3

Target Antigen:

BCL2-like 2

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

11/14/2019

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  IHC NCI60

CPTC-BCL2L2-3 IHC NCI60

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-BCL2L2-3 IHC Tissue

Result: Positive

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-BCL2L2-3 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NAPPA
Download This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique. (689.6 KB)

Evaluation of antibody by NAPPA

Result: Positive

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.


Characterization SOP Files

  NCI 60 Protein Array

CPTC-BCL2L2-3 NCI 60 Protein Array

Result: Positive

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-BCL2L2-3 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-BCL2L2-3 Western Blot

Result: Positive

Western Blot using CPTC-BCL2L2-3 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10179

Antigen Name:

BCL2-like 2

CPTC Name:

CPTC-BCL2L2

Keywords:

BCL2L2; BCL-W; BCLW; KIAA0271

Function:

This gene encodes a pro-survival (anti-apoptotic) member of the bcl-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis.

Relative to its Bcl-2 counterparts there is considerably less data on this particular protein however much effort is being made to further understand its cellular roles. Located on chromosome 14q11 it appears to be redundant in most tissues apart from specific examples. It was originally discovered by Gibson et al.

Gibson L, Holmgreen SP, Huang DC, et al. (1996). "bcl-w, a novel member of the bcl-2 family, promotes cell survival.". Oncogene 13 (4): 665

Chromosomal Localization:

14q11.2 - q12

Expression System:

E. Coli

NCBI Accession Number:

NM_004050

Swiss Prot Accession Number:

Q92843

DNA Source:

HIP:HsCD00000436

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

33523

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMR
AAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLV
AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEF
TALYGDGALEEARRLREGNWA

Native Sequence:

MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

Calculated Isoelectric Point:

5.06

Molecular Weight:

18629

Last Updated:

11/14/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of Ag 10179 (with molecular weight standards in lane 1)
Click image to enlarge

Ag 10179

PAGE of Ag 10179 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com