Brain-Specific Angiogenesis Inhibitor 1 Peptide 1


Catalog Number:


Target Antigen:

Brain-Specific Angiogenesis Inhibitor 1 Peptide 1




Mouse Monoclonal Antibody

Last Updated:


Antigen Recognition(s):



Characterization Data [Compare Characterization Data]
Click to enlarge image Immuno-Precipitation Mass Spectrometry using CPTC-BAI1-1 antibody with CPTC-BAI1 peptide 1 (NCI 00083) as the target antigen. Click image to enlarge


Result: Positive

Immuno-Precipitation Mass Spectrometry using CPTC-BAI1-1 antibody with CPTC-BAI1 peptide 1 (NCI 00083) as the target antigen.


Catalog Number:


Target Antigen:

Brain-Specific Angiogenesis Inhibitor 1 Peptide 1




Mouse Monoclonal Antibody

Last Updated:


Antigen Recognition(s):



Characterization Data [Compare Characterization Data]
Click to enlarge image Immuno-Precipitation Mass Spectrometry using CPTC-BAI1-2 antibody with CPTC-BAI1 peptide 1 (NCI 00083) as the target antigen. Click image to enlarge


Result: Positive

Immuno-Precipitation Mass Spectrometry using CPTC-BAI1-2 antibody with CPTC-BAI1 peptide 1 (NCI 00083) as the target antigen.


Catalog Number:


Target Antigen:

Brain-Specific Angiogenesis Inhibitor 1 Peptide 1




Mouse Monoclonal Antibody

Last Updated:


Antigen Recognition(s):



Characterization Data [Compare Characterization Data]
Click to enlarge image Immuno-Precipitation Mass Spectrometry using CPTC-BAI1-3 antibody with CPTC-BAI1 peptide 1 (NCI 00083) as the target antigen. Click image to enlarge


Result: Positive

Immuno-Precipitation Mass Spectrometry using CPTC-BAI1-3 antibody with CPTC-BAI1 peptide 1 (NCI 00083) as the target antigen.


NCI Identification Number:


Antigen Name:

Brain-Specific Angiogenesis Inhibitor 1 Peptide 1

CPTC Name:

CPTC-BAI1 Peptide 1


Brain-Specific Angiogenesis Inhibitor 1; GDAIF


Angiogenesis is controlled by a local balance between stimulators and inhibitors of new vessel growth and is suppressed under normal physiologic conditions. Angiogenesis has been shown to be essential for growth and metastasis of solid tumors. In order to obtain blood supply for their growth, tumor cells are potently angiogenic and attract new vessels as results of increased secretion of inducers and decreased production of endogenous negative regulators. BAI1 contains at least one 'functional' p53-binding site within an intron, and its expression has been shown to be induced by wildtype p53. There are two other brain-specific angiogenesis inhibitor genes, designated BAI2 and BAI3 which along with BAI1 have similar tissue specificities and structures, however only BAI1 is transcriptionally regulated by p53. BAI1 is postulated to be a member of the secretin receptor family, an inhibitor of angiogenesis and a growth suppressor of glioblastomas.

BAI1 (brain-specific angiogenesis inhibitor 1) is a protein-coding gene. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is UNC5B.

Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Likely to be a potent inhibitor of angiogenesis in brain and may play a significant role as a mediator of the p53 signal in suppression of glioblastoma. May function in cell adhesion and signal transduction in the brain.

Chromosomal Localization:


NCBI Accession Number:


Swiss Prot Accession Number:


DNA Source:



Synthetic Peptide

Vector Name:


Extinction Coefficient:


Expressed Sequence:


Native Sequence:

pqhdglrpragppgptddfsveylvvgnrn psraacqmlcrwldaclag
pqtgdpaaeew spwsvcsstcgegwqtrtrfcvsssystqcsgplreq
syg gaecqghwvetrdcflqqcpvdgkwqawaswgscsvtcgagsqrre
rlirkrflclgwglpalvvaisvgftkakgystmnycwlslegg llyaf
aahpgpstgpstknenvatlsvssl errksryaeldfekimhtrkrhqd

Calculated Isoelectric Point:


Molecular Weight:


Last Updated:



Characterization Data


No SOPs available.

Don't have Adobe Reader™?

Get it for free at