APEX Nuclease I


Background

Catalog Number:

CPTC-APEX1-2

Target Antigen:

APEX Nuclease I

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

10/10/2019

Antigen Recognition(s):

SOP:

Purchase
External Links
Characterization Data [Compare Characterization Data]
  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (114.8 KB)

CPTC-APEX1-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000 Click image to enlarge

CPTC-APEX1-2 IHC Tissue

Result: Positive

Tissue Micro-Array(TMA) core of ovarian cancer showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-APEX1-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-APEX1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-APEX1-2 Protein Array

Result: Positive

Protein Array in which CPTC-APEX1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-APEX1-2 as primary Ab against Ag 10750 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-APEX1-2 Western blot

Result: Positive

Western Blot using CPTC-APEX1-2 as primary Ab against Ag 10750 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


Background

NCI Identification Number:

10750

Antigen Name:

APEX Nuclease I

CPTC Name:

CPTC-APEX1

Keywords:

APE; APE-1; APE1; APEN; APEX, APX; HAP1; EC 4.2.99.18; REF1; REF-1; OTTHUMP00000163988

Function:

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.

Repairs oxidative DNA damages in vitro. May have a role in protection against cell lethality and suppression of mutations. Removes the blocking groups from the 3'-termini of the DNA strand breaks generated by ionizing radiations and bleomycin

Chromosomal Localization:

14q11.2

Expression System:

E. Coli

NCBI Accession Number:

BC004979.1

Swiss Prot Accession Number:

P27695

DNA Source:

xxx

Immunogen:

Recombinant Full Length Protein

Vector Name:

HIP : HsCD00003335

Extinction Coefficient:

56568

Buffers:

PBS

Expressed Sequence:

SNAMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYED
PPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQET
KCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIG
DEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLK
GLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAV
PLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCD
SKIRSKALGSDHCPITLYLAL

Native Sequence:

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPD
QKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCS
ENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEE
HDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLA
SRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLA
DSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL

Calculated Isoelectric Point:

8.33

Molecular Weight:

35.55

Last Updated:

10/10/2019

Links

Characterization Data

Gel

Click to enlarge image PAGE of APEX1 (Ag 10750) with molecular weight standards (lane 1)
Click image to enlarge

CPTC-APEX1 PAGE

PAGE of APEX1 (Ag 10750) with molecular weight standards (lane 1)

No SOPs available.

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com