APEX Nuclease I


Background

Catalog Number:

CPTC-APEX1-2

Target Antigen:

APEX Nuclease I

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/19/2013

Antigen Recognition(s):

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-APEX1-2 as primary Ab against Ag 10750 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-APEX1-2 Western blot

Western Blot using CPTC-APEX1-2 as primary Ab against Ag 10750 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-APEX1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-APEX1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-APEX1-2 Protein Array

Protein Array in which CPTC-APEX1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000 Click image to enlarge

CPTC-APEX1-2 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000

  IHC HPA
Download CPTC-APEX1-2.pdf (114.8 KB)

CPTC-APEX1-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10750

Antigen Name:

APEX Nuclease I

CPTC Name:

CPTC-APEX1

Keywords:

APE; APE-1; APE1; APEN; APEX, APX; HAP1; EC 4.2.99.18; REF1; REF-1; OTTHUMP00000163988

Function:

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.

Repairs oxidative DNA damages in vitro. May have a role in protection against cell lethality and suppression of mutations. Removes the blocking groups from the 3'-termini of the DNA strand breaks generated by ionizing radiations and bleomycin

Chromosomal Localization:

14q11.2

Expression System:

E. Coli

NCBI Accession Number:

BC004979.1

Swiss Prot Accession Number:

P27695

DNA Source:

xxx

Immunogen:

Recombinant Full Length Protein

Vector Name:

HIP : HsCD00003335

Extinction Coefficient:

56568

Buffers:

PBS

Expressed Sequence:

SNAMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYED
PPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQET
KCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIG
DEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLK
GLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAV
PLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCD
SKIRSKALGSDHCPITLYLAL

Native Sequence:

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPD
QKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCS
ENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEE
HDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLA
SRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLA
DSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL

Calculated Isoelectric Point:

8.33

Molecular Weight:

35.55

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000
Click image to enlarge

CPTC-APEX1 PAGE

PAGE of APEX1 (Ag 10750) with molecular weight standards (lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com