Aldo-keto Reductase Family 1 Member C1


Background

Catalog Number:

CPTC-AKR1C1-1

Target Antigen:

Aldo-keto Reductase Family 1 Member C1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/11/2014

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1C1-1 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-AKR1C1-1 Western blot

Western Blot using CPTC-AKR1C1-1 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1C1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

  IHC HPA
Download CPTC-AKR1C1-1.pdf (87.5 KB)

CPTC-AKR1C1-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-AKR1C1-2

Target Antigen:

Aldo-keto Reductase Family 1 Member C1

Isotype:

IgG3

Species:

Mouse Monoclonal Antibody

Last Updated:

04/02/2014

Antigen Recognition(s):

External Links
Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-AKR1C1-2 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-AKR1C1-2 Western blot

Western Blot using CPTC-AKR1C1-2 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-AKR1C1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  Cross Reactivity Data
Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens. Click image to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

  IHC HPA
Download CPTC-AKR1C1-2.pdf (118.2 KB)

CPTC-AKR1C1-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10013

Antigen Name:

Aldo-keto Reductase Family 1 Member C1

CPTC Name:

CPTC-AKR1C1

Keywords:

AKR1C1; 2-ALPHA-HSD; 20-ALPHA-HSD; C9; DD1; DD1/DD2; DDH; DDH1; H-37; EC 1.1.1.-,EC 1.1.1.149,EC 1.3.1.20; HAKRC; HBAB; MBAB; MGC8954; OTTHUMP00000018992

Function:

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Converts progesterone to its inactive form, 20-alpha-dihydroxyprogesterone(20-alpha-OHP). In the liver and intestine, may have a role in the transport of bile. May have a role in monitoring the intrahepatic bile acid concentration. Has a low bile-binding ability. May
play a role in myelin formation.

Chromosomal Localization:

10p15-p14

Expression System:

E. Coli

NCBI Accession Number:

NM_001353

Swiss Prot Accession Number:

Q04828

DNA Source:

INV : 4662654

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

37610

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFR
HIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRP
ALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCAT
WEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYF
NQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKK
HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID
GLNRNVRYLTLDIFAGPPNYPFSDEY

Native Sequence:

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHID
SAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALE
RSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEA
VEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQR
KLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKR
TPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY

Calculated Isoelectric Point:

8.01

Molecular Weight:

37061

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click image to enlarge

Ag 10013

PAGE of Ag 10013 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com